============================================= ./texts/FBIZodiac1/1.txt ======= SUBJECT: [3;r~~F*nur Leigh mien FILE NUMBER: 8&5-»E§-f3F—q‘-I*+‘4’7 KKXXEHEDDGEHKEEKKKKECXXEK KKKKKK X NC! DUELICATICBI FEB 13! F‘-KKKXX X FUR TI-i[1'$ PAGE 3 2-GIIGEKEE XKKK3Xfl3EKHKK K ============================================= ./texts/FBIZodiac1/2.txt ======= bu. rem - 4%"?/ff TD: SAC, SAN PRAHCIBGU {352E—S?-new; sexy SUEJEET: uneua. AKA ~ exec": 333.233 05' 9 EEUMICIDES, 1955 - lsirl; on: San Francisco HEM-'C: INTERVIEW‘ STRATEGY Vallejo Felice and Department were refer: 0 Si’; by the I{C3a.‘«_-‘£2 to eeeist the-In .1.n. captianed matter. nd advised that they have resurrected captiened homicitle investigation and are u:u:re conducting a backgrnugni an a possible suspect ARTEUR L-EIGBI. EN. Vallejo Police have requeetea aeeietenee 1_r1—'—'—- !@ ‘§EeeartE§“§fi‘1nte:v1ew strategy for ALLEN. Because vallejo is in the Sacramento Di-visien. SEA - tel-ephonically conta d that office to advise them ' t 2: e referred valleje ta SA AGEING $UF‘£:iWISDR Hes telepuenieally a sa ee that 3:; mule e filing is matter eut-. of the Sacramento Div e on, and he subsequently nr;-ti flea 3-.530 GDVERT. 5?; met with“ Am: -511 February 28. 1§*5|:‘.. and Mar ED. 1391 in order-to flier.-use specifics of their inuestigetiun, and obtain. relevant d1:u:’3.um=.-nl:5. Sh. will melntain all police reports for review. These decumen e wlll he finrwarfled t-:- the mevcg ATTH. ES.1L—u.tlder eaparate cover. F-ECOI*d1fiI'§|'DA’I'I DH: It is r esteri that-_. a 2515 matter be as-.p.*r1 and assigned to 3!: £‘ ============================================= ./texts/FBIZodiac1/3.txt ======= «em-~ 191 sec. sns Esnncisn {2s2s—ss—9eaw} use zjflraz 5&- EGDIAC Sub;-rel: .met en two separate occasions with anfi cf the Vallejo Police Department regarding ceptiened matter. These two meetings lastefl a total cf apprnrimetely ten hours. These-investigators were interested in an interview strategy fer a possible suspect ARTHUR - LEIGH ALDEN. However. they indicated that they had a consieerable amount of investigation to conduct print to contacting ALLEN. serves a search warrant at ALLEN'S residence at which time they cnnfrnnted him with bein the "ZODIAC" killer. He denied the charges. They indicatea hat they had subsequently interviewed him again. on all occasions, ALLEN was calm and cooperative, but fleniefl any involvement. shertiy after these meetings nccm-:rec,_ investigators g This case was left pending because the seileja police indicated that they wanted adfiitiuhsl assistance in their investigation as infsrmatien dsveln ed. The re this case was left open until 3!23f92 when was ccntacted and provided a status report en_ . ee memo dated 3!23i92]. Because of Shqceeeinad during the last year with prinrity matters, espee e 3 1-1433, ?—15ll and ?—i51?, no regular memes have been placed in the file explaining the reasnn to have the case remain open. A memn dated 3fz3f93. which is ccntainefl in this file, has requested that this matter be closed at this time. , ============================================= ./texts/FBIZodiac1/4.txt ======= » FD--55 IIRFEI-'. 349-35] r J ' '59‘-l¢|\'l.I'IB.1.'.fl'b.'t 19 12 13 14 15 ]".|' 13 20 3! FBI TRANS-la-IJ’I' $31.1: PBECEDENCE: fL.A.§S]'PlC.tTIDN: [:1 Teletype [3 Immediate |:.‘ Till? saacnrr III Fansimilt E! Prim-xiii‘ Ci szcm:-: E AIRTRL [3 Routing El CONFIDENTIAL III IJNELAS E. F 1' 0 El UNCLAS ‘ . Date 11525591 _ arc: - sac, saw FRANCIS .kT‘I"iII: ISAC nI!J-HIV! T —w?? —. e«/2%: FRDH : SAC, C:LE'i:’EL3aNI1 (5.2-I3 .. 42;:-—JF - SUBJECT : STIC POLICE coop PATIOH z §a - .r,d - fair? = ,;.r},/so Re IR); phune cal}. to Ear: Francisco, 11f1B/53.. /9‘ San Francis-an (Enc. rs’ -Cleveland {3! II I : slumber} TI-Eliflitltd =I¢:!:-.:.-z.=z;'a'.s.a: m.'.a.=.usa;-:» -gmmxan F1 ============================================= ./texts/FBIZodiac1/5.txt ======= -e-van [¥t=v. 3}-:1-Qt] FEDERAL BUREAU OF INVESTIGATION EUIPA ‘DELETED PAGE INFBEMATIDN SHEET . E Pilfiflsi wit]-meld 3I;ttiJ'a:l}.r at this 1::-salinn in the file. Gtle or more of the following sta.teme1:t.5, where indicated, explain this deletion. E petettous were made pursuant to ‘the exemptions indicated below with on seer-egabla material available for release to you. §.553.ie3_§.§I-3-. ii El U=]{1JI El thilmw CI (dim D cu]-{2} III chime: El Ute: |:| ct+J=:31 E‘! tb)(73ECJ I:J mm E1 Ebilfiltfll C|El=IIE1} |:I mlmtzn CI uoti} I:I tnmnrrn IIJ (vat-e El {b}(4) Cl (W83 '3' [tlE—d9£E]C1.1_ai.ad inffl-{ma oiinzhcrui P and fiiwere e -use pr or e an etv ew Ia A-LEN ey S 01.: attempt to obtain as much current informationiabout him as possible. and _ subsequently indicated that they had ohtatned a search warrant of eLLEN=3 residence, the basement ayartment of hie deceased mother’; residence in Vallejo, Gelifornia. ALLEN has lived in this apartment since his release from M-aecedero State Hospital. Investigators described this E‘?-fitment as very dark and :1 ea: almoet "museum like". During the service of the warrant, w and interviewed ALLEN about the "aonrer." icslllin e an ALLEN en any involvement in the 1"“-"P531"-‘E5v_ end fidescribed ALLEN es very amiable, calm ea:-:3 cooperative throng out their interview . . . izweetigatore he was a "nice guy": althgugh he P18-ESUE-E from sadistic type porno agliy. ALLEN that an audio tape which they f :5 dozing the in wnich he [ELLEN] is spent a young boy eh-: ============================================= ./texts/FBIZodiac1/8.txt ======= 70 Pain, ngcgpding to ALLEN, he fiound this tape to be sexually stimulating. ALLEN was shown a piece of yellow lined paper which contained a "menu" for making a bomb. ALLEN told invsstigatsrs that he never saw that piece of paper beffirfli End dfinifid hB?ifl§ left several bombs in a friend's hasement years ago. , Every item in hhLEK'S resifience was searched, including all of ALLEN'S the hooks; personal belongings. diaries, records, etc. No evidence tying ALLEN directly to the ”EUDIAC" murders was recovered. _ The only assistance which sawwas able to provide Vallejo Police Department at this time, was to suggest that prior to future contacts with ALLEH, investigators shoulfl have all of their other interviews completed so they had as much hackgrounfi information as possible on ALLEN. Fo]_LD?Jing two meetings with - and —, no infiormation was received re arding the status of the investigation. was contacted on March 33, lS91 regarding eeptione ma er. indicated that his fie artmsnt was still investigating ALLEN as the Efifllflfl killer. insieated that a surviving victim from the ZODIAC series of murders had positively identified ALLEN as the ZODIAG killer, was currently in Germany following up on several leaes. indicated that the one ma or problem in the current investigation was that ALLEN's hen writing aid not match "ZDI:-IAC‘,$'-' handwritings, The experts explained that the only explanation for this would be ii ALLEN would have heart able to aeselop a "false handwriting“. — in-fliceted that they have interviewee annns on several occes one during the last year. During all of these interviews. ALLEN was very cooperative sith police. but continues to deny that he is the “ZODIAC”. ‘ advised that there were two additional interviews to he conflucted on this case. These interviews were with people who have known ALLEN for a long parioe of time, anfi therefore would be able to provide a significant amount of hactground on him - especially during the time that -sonzacfi was fiflmmitting his hnmiciflee. once these interviews have been fiD1115UE=t‘3d.F indicted that he and. will present a full reeiew of a case to the snnoma County is riot attorney's office for an opinion regarding possible prosecution of ALLEN. If the DA refuses to file charges against ELLEN, Vallejo Police De artment will close its investi ation on the "ZODIAEF case. *1:-i-:1i::ataa that he will not :5» SA—as to the date an ime Of the meeting with the nistrict Atturneylg office as 2 ============================================= ./texts/FBIZodiac1/9.txt ======= fihat she can attend. Vallejo has requested no further assistance on this case, and it is therefore recammendsfi that this case be ¢1u,ss_d at this ‘time. é sz/A/.¢a» /ZAC '1?/’ #:5v"n'.’L 45*’ «-‘*‘1*L”‘’—’5’:f«? L ============================================= ./texts/FBIZodiac1/10.txt ======= Merrmrahdum " T? SAC, SAN FEARCISED 1252E-~S§‘—9-¥:Ii?] 9*“ 3.-"-fiffi? ‘A. alleja Folise Departmnt. _ Attached to and cunsiderefi art of this :n c is the iollowiig documentation provided by ‘ ami _. 54:13 I: --.._— -. 10. EEt1:1.3::1 of -service of a search warrant datad February 13, 1391. warrant was served at ALLEN '5 residence, 32 Fresno Street. Vallejo. California. «'11. Affidavit for above search warrant. nj-—:P . 2. 5”’ j" 51¢ 3" 13 51¢. :5: E-SF: 694%? —-_=_: ============================================= ./texts/FBIZodiac1/11.txt ======= *’”'* - i ‘/21, Affiniavit far a Search warrant far AI.LE.N'S Santa Rosa trailer, 1972. I '33. any of an article entitle ‘Insanity Defense", V . at e _- January 10, 19:-‘S. ============================================= ./texts/FBIZodiac1/12.txt ======= 4.-arse (Bu-_ 5-21-es) _ I FEDERAL BUREAU OF EWFESIIGATION FDIPA IiIILE'.l'.EJJ PAC-E INFORMATION SHII?-T E Pegefisj wiflflleld entire]? at this lecatlen in the file. One or more nf the falluwing stabenterlix, where iudieebed. exniein this deletion. Deletions were made 1:Iu.reue.11t be the exemption: indicated below with at} eegreg,-able materiel aw.-aiéeble for release to you. eas.t;9:e_ea2 i 55 El [!:-){1} El thnitxn} |Z1I2IiJ(5J El {bill} [I -[hII(’?3I{B.‘a E! mm D [E:-H31 El I[bJ|1”?J(C) I:I (kills) ' E‘ tbnmtn} El u<:u(2:n I:I cannula: El nets: 1:! chnmtfiu Claw: III -{hm _ El tabla} El nuts) 3 can-:51 13 (art?) Elma} U 031(6) El {ICIII7} El Iflfflraflefitiflfi 13¢‘-rtain-3-:1 uulzr tn a third party with no reF¢r$I:I¢e tn lhe subject of your request. El Iflfflrmafififl fiertajned only to 31 tltini party. The subjeet of your request: is listed, in the Izitie on}:-, ' El DOGIJIDIEIIIS originated with a.,|:I.cIthIer Government age1:c],n[;i,es‘_r_ These documents we]-e gefeg-ma to that agencyfies} fur review and cllrect response to yuu_ Pages contain informaflnn furnished try another G-mrernrueul: agent-_v~[iesJ. You -wit: be E|.Q3V5~%Bd 132:‘ The FBI =33 W the nele:-eabiJiI:,- -If this infwmatien ffllluwlug our nnnsultation with the other egencg-{fies}. Pagate} ‘R-'1't|lh6II2|. inasmuch as a. final release determination ha; .-mt been r.|'|_a|:[g_ You wil; be edvked B3 to the Elisbflfiitinrl at a later date. Fag-S5 were not considered For release -3.5 I:J1e1_.' are |:1_1_'|]:|]in:Q_|:i_1.'g of El Fer yam‘ ififmtmatiuzrr-: ;fi'ThI:: fctflowing number is in he used for :|'\¢fg:3'u-pg 1-Egg:-djng mega pages: ,_e3§'d -5*"-‘ ‘F44? 7* d"',aj=J,_~3- J; }G{}i}fli5fi‘E}iCti2{}i}fli}{}fl‘Z}{}flfH}fl§ I-E DELETED PfiIflEI{$]I K ).']€'.'~!'.'<3I.'J[ END DEVPLICATIUN FEE K FQDRKXI - . X FOR THIS PAGE X I-lI=D§J{3G( §ClD{3s'3-DCEEIQCECE-C}§}C)t3{I§C5DE5{3Ce:Tr:Z!C TBHDUI ============================================= ./texts/FBIZodiac1/13.txt ======= A L J «er «_ %. .- ,,.;:=L “F. §(g[ume_2G, lssue§'=16 fiésd<::§F."AriI 19-; 1939 L- ofihCqp . H .- wnitewué? " If? tiffing I'.>'re'-.riew._-' ============================================= ./texts/FBIZodiac1/14.txt ======= Hrflhafi E.._._...._..r£ .:.wfi :..._tS.:..F.._ E2. tic .....- . . nfim_..—+....m. _+.. . .t...... . ... .._. E$U wm_m....:,.. .: .. . mfi ...§.§fi ..u..n.__m_=.... 5:...“ Du.fiE...__. .._:.._H..m man .... n ... .. ..:._..r. . man ..u..mu..._,mmnEHnm Fun u_.naw =.._.mw m. . ........_. .. .. _..m_»;u. E. mfififinfl .5 En. . . . . . 5...... . E55. :33. «.2 .32.. _.. mat; ....u...B£naam E5 ...__...nn_u. .. .¢E.E.&...n..n§.. Eur mm as 5.0" _ _ ......_........................._............ ..._ EH2... nah... E £.._on.$.munn5n Hi awn... .. 5_.n...a. Ham 5 55... E. m _n—.._.._..w a..:§...a:u._w__. ...... .........m....M........fi....._................H........fl....a . .132 ¢..E E3 338 Shaun. u E.3.._.fifl. ma: mufidflu. mun _..E__u.=.£..E. on Uu_m....mua. . «BE nE£_nHn_nnanfi¢wn- firm.e:d.wI1en a fiaurth ficfim wa,a:h,£.%th3:ch&atinCeu,- _ wmbe tI'E.lP‘$ 'E‘5I.l'hl'3-1Ji33.|!I3l-]i.E&- _ . a leaabaiijr, irwestigamrsfmntfl Len. ’I‘hat fieagfiached ‘wild.- amther no-is i:;.I:he same 5l'I?PIDP9t'ti-DW1Si'||-9ht§1eNsw- 'I'h.e math 1.-14,-fin, = handwriting as the othezs, York Dmbfle-ya pubhghea an; Pa_1-mm [cmgm Wu rum. filled with astral-agical rEafE1*- Shir? 1:I:r_ if-5 55501 eriug from his wounds whe em J1-Ilflum 1:. Ha Italics k :1 W .' " t: B:1pHhH.B' E} OF Ike three |IrIw'.‘Lans II'ic:tim$, m1-e haul d.i.ed.They W'E'l'E I Mar§u'D1'~ato {Scnrpio}, 9,5-O- 3.nea.1-—eir.1 fiather of min, walk- ing with 5| ca.-us. was glmt Mal-|:h E in Brooklyn. U Germaine In-iflnteneadru { }, 33,'ahJ:It March 5'9 : w]:_j.iI2 31-i a subway may ' !io:a,n1:ha£§ruukl}1-.. _ 3 - i = "K a. ' ' 0 Jose We{'1’&bn=a1.a=I=ot The damu1Ied Idilain mam .,. fly... ' . _ M53 31 while 1:raLkiug Mm-e Jugs. says on u'Ffl::iaI_- "nm 33.... g.§n".’E{;f§:°§.';T,,d. -lshl -=wz:‘|11':|:|.|:Lf.’I' " " s:ev::_rsJ.u'\enfla<3/I_§§ErB-ecazlaaeoal’ writ: °T'1:IEE .. an |:I:-' E115 aliofth-ea-a.rm.-uksnfzoda ============================================= ./texts/FBIZodiac1/19.txt ======= i'I1dd-elad jig nu; !5I_-J-BPII1 Ru?|_|!5ul Far- fiurfieuplehgaidniwen agnybuthzia-ah'.|I$&1':§,, I1P9.I:tufmu' 2-- 'gmre I15 31]’ .._.4 J-Inn-ur- $13399: Balm his ¢IiI'J'-as tn 5 I § 3' Iain: --was 9:? furm.=.1:io'|1le:uii' bufi.1.eBap- _ : lure of the Ftiliue ‘d-E'v5Gl'|]1‘13|1|1' man Bet. -altmph Mr.“ . I M I . 5qI:\I2da§;li.‘l.|3€Z¥.‘.Ig'arInva1-:1 fqu_-i_n- ""‘-’ - - - I " ' --------- ============================================= ./texts/FBIZodiac1/20.txt ======= -I-trsla :34-v. 941-94} @7953 FEDERAL BUREAU l}F INVEITGATIDN FDIPA ].‘IELE'I"EB PAGE INFOHMATIDN SHEET !i_'£.'J- Pagn-2(5) wiihheld entirely at til-1'5 1c-cablon in the File. the 4:: mum of the following statzlmants, where indicatad, explain |:J:u'.s d¢|etiu:sn. Iflfleli-t1uJJ.s were made pursuant to 111-2 exemptions indicated beluw 1.‘-riLh no segregable m2!E:r'ia.|_ -avaihble: for ralsase: to you. Sec!‘ figntiun Sig El cumin CI (bJI{’J‘I|Uu} El <-:uLs;: I3 n:-H2) El {humus} r:I {m2} III rt:-1-:3) I:I [hJE'?}-[CJ 8 min Jxj {bJF3'}[DJ- III III-=}[1]I III mm-xzzf |:I may El ua;-mi}? |..__|El-.'.‘l [-1 rm I— It! hil- I3! IO III E the name he knew to be the Zodiac to his Attorney — % b 1° years in prison. He is new fifty years of age. Detective ‘indicates that _wi11 not divulge whet" infm-metien he has regarding the Zia:-diao unless some type or deal is suede regarding his present offenses. In early .‘.|'anua.r_-,r 1.991, I and retired Detective‘ -‘contaot:ed—at the sentalciars county Jail. -refused to divulge any information regerding the name of this person he knew as the zodiac without first being offered a deal; wherein, all of the charges against him were dropped. Retired Detestive-_ and I refused to make any type of deal like this. —-was asJc.ec1’how he knew this individual he would not name was the Zodiazo, and he made a a statement, “He told me he was going to Ban Freneisoo and 1:111 a cab driver. The_ next day or so an oak: driver was killed in 3-5311: Francisco, and the Eu-6.13:: took oredit for it." —suheeq1::ently agreed to give - a deputy public. defender of Santa Clara county. Throughout January of 1591, subsequent meetings were hm with j ‘j im+a='~a=»= ms regerding the information —.'n.a.-d. They refused to divulge any further intonation without; -some concrete deal. being given to — which we rafuged to do. ============================================= ./texts/FBIZodiac1/34.txt ======= Itfl-Dlfllxltmlfilh-Ed-I!3|-Ii‘ 10 I1 12 13 H 15- IE 17 IE IS‘ 31 23 2-1 25 B3 . I was readily aware of the Lee 3.1- 1211. I contacted retiree Detective — and he advised me that me er the primary suspects in the zodiac case wee investigated bee}: in the early l9?D'e was an Arthur Lee Allen. oz-L Febrtlery 5, 1991, retired Detective I went tr: beparment ct muetice, Sacxrenentu Hemicicte Unit. This unit is the receptacle for all zodiac casee investi- gated by various pelice departments thrcrugheut the State ex? califernia. The person" in charge of this div-ieien ie an Agent: Agent ——eupp1ied us with the reports pertaining tn the inveetigaticn er Arthur Leigh Al- len, -NH, DU-B 121333. These rec-crude reflected the primary investigation involving Allen was emmuctee by the sen Free-_ niece Police Department, specifically Inspector -and 1=*m=t=-‘r — Attachment A to this affidavit is a copy er the city cf Manhattan teach Police Department reported dated July 19, 19?1, which indicates haw I &-and‘ became aware of Arthur Leigh Alien through information sup- plied by a—W a— — Attached 3 ie a copy of the afiieavit fer eearch warrant prepared by Ir-aepeceerv-— cf the San rrancieee Felice Department datea September 1:1. 19-12. This affidavit indicatee that in 1972, Arthur Leigh Allen was residing at t2*..=_- Sunset Trailer Park, 25153 Santa Rosa avenue, Santa Rosa, California, Spence A-‘F. b‘I¢ ============================================= ./texts/FBIZodiac1/35.txt ======= ¢:-::r!-htoI-.'.|I-- : have been informed by retiree -th.at en February 5, 1591,. he was able to cuhtact new retired Ir1epe:3-- tar ‘ti the San Eraneiecu Pu-lice Depart?- ment. —infur:Imed Detectzivehthat he had, in tact, served the aferenentienefi search warrant at the .traiJ.er in santa Rosa, and tnet present euxing the time ef E Inl- III- 1- B3 I-I D5 I'\-I IF: 4-1 ‘DI Iul GO- I-l "Q u-4 H 1... ID 3 ‘I: II- E2l‘3%fi§E3E the service df this search warrant was-Arthur Leigh Mien. “indicated that there was nothing linking a11en he the Zodiac case fmmrl in the trailer. ‘indicated that Allen coaperatea with the investigation and wet; hand- writing exemplars with both hie right and left. hand [Allen ie amgsmextzausy . —indive::.ated that hemwxgn-fig gm. P3-E5 ‘Of 131-‘«§'¥'|-'|1‘." I-Sigh Allen were submitted to hanniwriting experts with known writings -at’ the zodiac killer. Enrperte indicated that the handwriting was 5;L,1u;i_]_a,r but definitely was nut that of the zodiac killer. —i11di1‘::ated that one handwriting expert. iden- tified ae — neparemeut of Justice Document mm- 5-1'I€1-‘; iriflifl-itéd that if writing had been a product of a, mental $‘=%*3B- the Writing of a subject can be different when in a different mental state, or it could he a case of an ifitenti-anal deception. And with the talents that Allen has {Writes with both hands} , this would be done. ‘ rec- emmenaatien Has.'*I}e not eliminate this subject-_ heaauga nf handwriting-“ Another handwriting ea.-pert, * who examine-:1 tne known ‘writing of the Enfliggr as 5,311 "as 111-En’5 indicated he did not feel a mental state would alter ============================================= ./texts/FBIZodiac1/36.txt ======= "«5mm-wmmn-tow- hi I-I 5-1- W F-I DJ I-I IP- IM- 97' eeeeeeeeeeeee handwriting. _indieated that he was never: able to reeeneile this problem. -3130 indicated whee serving the search war- rant. he had obtained finger and palm prints 9! =11-hjefit H.1- len which were compared with fingerprints feund on the cab being. driven by Paul Stine, their victim 05 a Sediae hemi- eide on October 1.1, 1959. they were unable te match finger- prints. —.vent en te indieete that there were 3:: many fingerprints in this public eat, that it is unknown that, if in fact, they have the zediee'e fingerprints at the crime scene or act. end that he else indicated that in eerme cf the letters that the eediec had bragged that he put air- plan; glue on his fingers to ehliterate any fingerprints. _etat.ed that of all the suspects they looked at in the Zodiec ease, he felt that Arthur Leigh Allen wee the meet viable- _indicated that he did n-at attempt to eeereh the reeidanee of Arthur Leigh Allerva mother of 32 rreene Street in the City of telleje. Be relied on Arthur Leigh e11er_;"e ' who we-e cooperating with the investigation to leak threugh Allen-‘e roan which was in the basement of this reside:-sea. :-inf-arr-med 111; that 1;; had observed some ¢r1'pte-gran:-t}'pe materials, but he was un- sure if they were related to the isediar.-. No further: action H°“'='*=*»I wee taken regarding a Search of 33 frasna. ‘did. indicate that he teund out later that Arthur Leigh 3!-11¢fl’S Spent at least two days per‘ week staying at ============================================= ./texts/FBIZodiac1/37.txt ======= bl . QKFGH-"'--'-I'mI|2fllPI'lDI\:'|'-‘ |-In I-II I-I IO incl [.5 III- Ii- I-L EJI III! 65 D-1- ‘-1 H1 E D-I 19' E 21 23 24 26 23 Me. his nether’: reeidenee and still naintai-nee his downstairs haaament heart-em. That, in tact, Arthur Leigh A.1lan"a nether Nnuld travel abroad frequently, and during these spans of sometimes months at a time, Arthur L3igh_A11en would reside in the family residence of 32 Frasne Etreat. Vallefie. This information was obtained by _£'rn:n Arthur Leigh ~AI1en'e— I _further indicated that Arthur Leigh Allen's name was never publiehefi in any media to his knowledge, and that the Only 9erauna'Uha would know this name are law an- forcement personnel directly related tn the zedia:-ihve5ti- gatinfil}, or as:-neene that Arthur Leigh Allen had pers-anally dealt with. Retired Detective -contacted retired. Department of Justififl 3-fififit _ -as-aisted— in the investigation of hillen. '_.i.ndi-tated that he had no knowledge of any ‘neclia attehticn given to Arthur Leigh Ellen regarding him being a auepeet inthe zadiac: case. Tc: - knewledge} the only persona that had any informa- tififl regarding Allen were law enforcement personnel. DE1‘-EI'=’Ci*-'9 _aI.'I£1 myself are both aware of the meciia attention given to the zodiac‘-ease in the valleje Area and know of no incidents where Arthur Leigh Allen's name ‘Has mentiflned as being a suspect in the zodiac case. This leads me to believe that _--had te have had personal. contact with Arthur Leigh Allen or with a close associate of Arthur Leigh Allen to -ahtain the flame or Lga 3.11am. ============================================= ./texts/FBIZodiac1/38.txt ======= isfflflfl--lfiI'€'*1FI--5!-I'\-7|""' 3-! ¢._u hi I-\'5 ‘Fr! LB Iv-b Hil- III! 13' III- flit I-I ‘--"I 1.: E0 “II E am aware that the zodiac wrete at least twelve let- ters to newspapers in San Francisco, *.-'a11eje, and Les enge- 1-es, and at least ene 1st-tea: to as ettuzrney by the name at h These Iettess were primarily taunting the police that they weulfi never catch him ea-Hi exhibiting a scare-indicating that he was beating San Fransisco Police Department. some of these letters also cnarrtair:-ed :::jfptn- grams which were -supposed to spell out the reasons far the killings and the 550-Lilia-E's inane. Nuslereue attempts have been naae to crack these cxyptoqrans with dubious results. Al- theugn the zodiac claimed many killings in the State of ualifernie, the ones that must cleeely can be attaributed to him, ‘sun! that are in the ‘i"a11I.!jO Area are as fe},,‘r.cn-rs: (1; Deaelher 20, L953 - Lake Herman Road near *.I'e11e;ie, Selene Gaunt}? 5I‘:e:.if£'_e Department Jurisdietion. vie» tims - Betty Jensen and David Fan-aday. The ueapcm uses in these killings was an .22 caliber semi-automatic pist-91. It is unknown if any personal articles were taken ire: either Jensen or Ferredey. Expenctefl .22 caliber slugs and casings available for comparison. I [21 July 4, 1969 - Blue Rock Spcrin-gs'.IL1:ee, '|'.I'a11ejt:, cali- fornia. Vallejo P:-use Department j-uriediction. ‘victims - Darlene ifierrin. deceased; a.I:u:il _ sh-at rurrnezeue times but lived. Heapnrt used - a 9 mm. semi—eutenstie pistol. Exp-ended sltqs and eesirig availfl;-Le fer crhnparisan. It is unxneen 1: any pet. sunal items were taken from Ferrin or- ============================================= ./texts/FBIZodiac1/39.txt ======= F. . :H§Bfl“|-1@CT11DIhI§-III-" |—I. |—|. n.|. N-V I-I. 1:-5 ‘|—II-II-I flitfllh I-‘I '-J L-I '55 1-1 tfi ha 5 MI I—I fl 3 24 E93 {3} {4} bwc September 2?, 1959 - Lake Berryassa Area, Napa County $heri£f'e Department juxiedictien. Victims - Cecilia Shepard, deeeased; and fistebbefi numerous times but survived. weapon used a a large knite ap- proximately 12" in length with e 1* wide blafie with a wooden handle with two brass rivets and tape around the handle.. engine this kiilinq. the responsible more e black executioner-type hood with a circle and cross an it, and was wearing black wing walker-type beets size 16 1}; regular. Peat eaetings are available for Cbmr parisen. It is unknown if anything personal items were taken iron: Shepard and u botober 11, 1553 r San Francisco. California - San Francisco Police Department jurisdictinn. Victim - Paul Stine. deceased, eat driver, Yellow cab. weapon - a 9 mm. semi-eutflmetic} Available are expendefl tesinge and slugs. Missing from victim Paul Stine was a por- tion of his grey and white stripped sports shirt that was taken by the responsible, Paul $tine's wallet with unknown type of identification, the cab keys to the_ afurementiuned Yellow cat. The person who identified himself as the zodiac subseqtently sent a letter taunt- ing the San Francisco Police Department regarding the death of Faul Stine. This letter contained a potion of the missing Shirt of Paul Stine. In the late 1910's the FBI at their training facility at Quantico, ?irginie, set up-n special unit identifiefi ae ============================================= ./texts/FBIZodiac1/40.txt ======= E1.I:I‘DI"'I-ll:lI-UFfl|I-'Di?lJ|-'- hfi ani- D4 14 Ian. uh- I— Ul I-I IO} H-5 ‘-1 Fl 55 pa. tu- B3 ED 10 14 E E1!’ h5- Ii- 25 ““ bm. VICAP which stands for violent crininal Appretensisn Pra- qral. This unit was made up ct‘ psychiatrists, psycholo- gists, and FBI Agents Hesse primary function was to make a prcfile an violent serial killers and sexual violators. The persons in this unit interviewefi eanvictee mass murders and sexual viclators tn fletetaiine what activated them. They were able ts-develop profiles of serial killers which have had uncanny results in identifying-the traits ct respcnsi- tales in serial nurder cases. on February '1, 1591. retired Detective _ contacted _ psjrchclagist, vxrzsr Unit, riuanticc, V5.2'l;l'.'E;1_'.I..'I.-a.:. -was familiar with the zodiac case. He was informeci cf the investigation by Detective _ in 19-91, and the moors recent infarestibn obtained fren- iin 1991. -indicates that his experience would show that the zcdier: killer prcbahly gained as much pleasure from taunting the police regs:-fling his killings sue! reliving the killings asna am cf the killing itself, - " -‘indicted that the killings would pzasasxy still be can» tinuing, and the only reason he gmsi think of that they were not was that either the responsible had ncvefl from the area. died, or that the police had came very class. to s»pp:re- - htndirlg him. -indicate-6. that his stufiies shew that persons whc commit these types cf crimes neny tines keep souvenirs or trophies Ercn these crininsl acts. These per- sons will take,-sums type at‘ article £1.-cm their victims such 35. itientificatifih. pieces of clothing, etc”. so they can -10- ============================================= ./texts/FBIZodiac1/41.txt ======= ’:'3:euee—.1I:hf.1#1l-bah-1*!-l u-I 1-u I-I N’! ‘H 15 1-5 1? I8 I 9 2! ti 3% E2 23 2'? 23 keep these in a hidden place and relive the incident many times ever. — else indicated that the persone respon- eihle for these 1‘:_I._rpee of crimes will Keep ire-urnais and news- paper clippings of the erines themselvee. ‘indicated that persons when keep these seuvenirs nan? times. have ingen-. i-nus hiding .p1aess within their residence such as, false walls. hiclden sates, etc. ‘else indicated that many times these type of individuals will have a star.-age place at another leeetian where they keep their trophies and seuvenirs. I was aware that Arthur Leigh alien was employed at the nee Hardware Store lncated at Anader E Tennessee Streets in F the -tit}! of Valleje. Retired Detective _w-ant ts: that location. Cnntaetefl at that lecatien was. ‘ -‘Eras known by both Detective ‘and myself 3.3 he was an aw-City ef Vslleje employee werkinq at the Carpo- retiun Yard fer many years. He is now retired and has weflcect for many years at the Ace Hardware Store. --wee asked if he knew Arthur Leigh 3-.i_‘Len.. '-indicated. he knew him quite well. am]. in fact, visits at his residence en azmst a ‘weekly basis. -‘indicated that Arthur Leigh Allen new resides at 32 Fresher street, city of Vailejeg that his 1W1‘-her 15 deceased, and Arthur Leigh Allen is the eniy one living !u*i.thi_11.'the residerlce. He indicated that Arthur Leigh Allen still maintains a basement bedroom, that has -¢-an- trel er -the entire house. -1’:- ============================================= ./texts/FBIZodiac1/42.txt ======= E‘!-llliflfi-«l|:ll§'I|lI-cal-sfli‘-F pa. n.d. in la: >—l- CI! ¢.|. {the I-ul. Uh he as I-I --‘I |-I. W 2! 25 C. ssilbeat which he keeps at s frienti-'s house located at 1545 ‘indicated that Arthur Lee Allen owns a 22 feet Broadway in the City at V-lellsju. _-indicated that this sailboat has sleeping q1.1arters en he-era. which unuld sllew a person to stay at sea fur days at a tile. ‘indicated that Allen has manjr guns in his resi- dense. was specifically asked sheet pistols. ' indicated that he knows of e ntmh-er of revolvers he thinks '- are .22 caliber, and at least ans semimautemstis pistol which the calib-er_is a —‘indicated that he has known Allen for approxi- mately the past ten years. fiinflicstefl that Allen has never dismissed the zodiac case with him. 1'-our affiant was infnrmed by Detective -that he went to 1545 Bruedwsy street is the City of Vallejo. This is a single star‘; residence located on tI']_._B ‘Nest side at the street. ‘I'D the nurth of this residence is e fletsch-ed double. car garage that is'f'L1l1 .9: '5-*a.ri4:!u.s household iteas. Behind this qerage in a vacant field is at sailboat,‘ approximately 22 feet in length, blue and white in esler, severed with a blue tarp. This ssilh-eat is setting an a trailer with cali- fsrnis license HE3'J25. Department at Hater vehicles regis- tration indicates this trailer is registered tn in Arthur I-eish Allen at 32 Fresno street. Also in this backyard area is in spprpximete 10 for:-t epen sailboat that resembles a rep heat. This hast beers license 912?!‘-‘. Department or Enter vehicles infiisates that this is registered ts an Arthur -13.. ============================================= ./texts/FBIZodiac1/43.txt ======= Blnsoo-ama-h-ten)»: an |_I. n...- In: E as lil- I-I {H I-- m I? Leigh Allen of 32 Fresno Street-‘ In addition to the previeuely-mentisned double ear garage, there was a large lean to type ste:-age area that isleppruxinately 4:} feet Icing and an feet deep. In additiun to this sterage area is an- other st-srags building just: to i:hs_|:'aar sf 1555 Broadway street. It is mflenown what these buildings may sentaih, and there is he request to search same at this time. ‘indicates that Allen ems an elder white Her- eedes, a blue wr Karman Ghia, and an elder black :15! vehicle. I was informed by retired Detective “that su.b'_"| ect Allen was arrested by the schema ceunty Sheriff's Ueyartment for 258 P.I::., mslating a small boy when he lived in the trailer court in Santa Ruse. In inid-19?-1., he was sentenced to Atascaders State Prison, and he was released from Atessaderc State Pris:-n in mid+1'.-‘Via, serving almost few: years. P-Lu-suant 1.'.o_these arrests, he is considered a‘ fele-n and can no longer mm handguns as the type dessribed _ There was a breach in time when‘ zodiac letters stopped being received.‘ This time is almest exactly the time that Arthur Lei-gt: Allen spent in atascadera State Prison with a kn-mm cecnfirzmed sadism letter an-:.i.*ir_ing in early 19?a, and then the last }.'.‘l10H1'I confirmed Zodiac letter being in _late 1973. Based on the foregoing, grout Affiant pray: that a search "warrant he issued far the residence at 32 Fresno .—13. Ma. ============================================= ./texts/FBIZodiac1/44.txt ======= mflP~Jd}lfi§-W909‘ 1D 11 I2 13 14 15 IE 17 13 I9 2% 2] 25 2? '23 "9- Street. city of Vallejo, County of Selene, state -of cali.Qr- nia and any out buildings on -said property, and an approxi- mately 22 foot blue and white oeilhoat on a trailer bearing California lioenee HE3iI'25 located to the rear of 3.555 Breed- wey Street, city of Vallejo, -countyof Selene State 0.1! celifcrnia. The purpose of the search warrant will he to attempt to ohtain any .22 caliber semi-automatic pistols, or .22 cali- ber semi-automatic ammunition or expended emrunition that may be linked to the death of_ Betty Jensen and bavid Farrar day on December 20, 1963. also any other personal items that flay be linked to either of thee-e individuals. Any type firearm that a flashlight may he attached to, to assist in the sighting of the weapon; any 5 mm. automatic pistols, or 9 on. ammunition or expended ammunition that may be linked to the killing of Darlene fierrin arui the woimding of- _'von July 4, 1955 in '-iallejo, California, army personal ite that may he 11.:-Lkecl to either Petrin or- any ksniveo that may he linked to the killing of Cecilia Shepard and the wounding of fion Septenher 2?, 1959 in “HP? Cfiflntih E1 black executioner-type hood with a circle anrl cross on same, black wing walker type boots: eize in 1}: R, any personal items that away he 1in;I-:ed to Shepard or - ‘ Any 9 ma. automatic pietels and ammunition. or ex- Pfinficd ammunition that may he linked to the killing of Paul Stine on October 11, 1969 in San Francisco, California. also a bloat] stained portion of a gray and white Etripefl -14-. ============================================= ./texts/FBIZodiac1/45.txt ======= F‘ . |:| ID W '|-I E U1 UFI (3 HI D-5 hi- n—a- |.n. I1: Lu. W i-I w-- I-1 ‘L’? l_I. £1‘! 18 19 21 E E E 26 23 Sparta shirt that may he linked to Paul Stine, Paul Etine'5 wallet and identifieetien, a tellew Cab taxi keys that way he linked ta Paul Stine’: taxicab! or any other items that may he 1 inked to Paul Stine. any journals er diaries that may be linked to the zediee eaee. any newspaper clippings that may he linked to the Eediae eaee, and any ether items that may be eennected to the zediee killings. Your Affiant arts that after the eerviee of this search warrant that the Search Warrant arfieavit and Return of Service be sealed by the eeurt. The reason this request is mate is that the andiac case hae had natienel publicity and nee been one of the few case that has so inflamed the public that it wuuld serve no purpeee fer the neve media to get infermatien frem thie affidavit if no chargee ere Eiled. In the other vein, if charges are filed, the publicity from this affidavit would tend to make it dififieult to have a fair trial. -15- ============================================= ./texts/FBIZodiac1/46.txt ======= 4-'25:: [Ru-. 9-2|-94] max)“ mflAt BU"R.IL1U OF INTIETIGATIDN FDIPA DELETED PAGE INFDRMATIDN SHEER-T 5'91.) P352-[5] withheld entirely at fl'.l.'i.5- location in tho filts. {)1}: or more of the Following, statements, where indicated. sxolain this deisiinn. E Deletion: were made pursuant to the exemptions indicated below with no $egreg_b]¢';'n-a_te;,-I3] available For release to you. §a—;.tm_;.§A a Eltbllttjt ' t:t fhl-{TJIEAII t:t-nttst ' I: (bit?) E] tomcat I: on: El (bl-{3} I3 thtmrct I3 outta QT [b.‘tET}£DJ' III -30:21 El ttattvtoat Effii-;iII:3? E1 {!z')If‘Fft{F]I III I:iJ for review and direct response :5 yau_ Pages contain iufurmtion furnished by another Government agencfiias}. You will he ‘3'3"'i5‘3d hit‘ me FBI 33 I11! HIE t‘ElrEfl.5al1:ili.!L'tI' of this- information following IJIEI cdusuitation with the other a,gEtnu3r[j5:]. ' Page-[.3] withhold inasmuch as a Einai re[-sass determination has not bang mafia. ‘fut; 3...-5_1_L hg advised as to the disposition or at later date. Pages. “'2:-5 not considered For ralsase as they are dupliaativg of CI For your information: ETIDEI following number is to uszd fotmfereacg rggardjjjg these pagagj £5; 25F " ‘?«~}#.-t";‘ ‘.7 - :3.» -‘ jg‘-.5’. 56”” .(a.§t" fimflflCQflDfiX X DELETED Pt-5t.GE[3} X Ivt'.‘{I=Ev:2-E11’ _ XNO DUFLICATION FEE X KKEQCXX K FOR. THIS PAGE X Iv1".'1‘.":.".‘-Dllfi xmmxH m IBUDUJ ============================================= ./texts/FBIZodiac1/47.txt ======= 1.u.u=;m1m1. arms: or In: any or am-ra. nus; ml: c::mIL'I:- or soflm-It smis or :a.L'mnn~.m rs crr cu;L1:n1uu.n +'-P1"l3|i*»'|-‘-1'“ WP- E331.-er": D1? Sblillt-IA SL9-R1-TH HERE-IlIH'E -I-he m¢,:.;@¢d gm; Etrn fiuly sworn. aeppggg gm.-I figure upon ‘[1850-‘ti! n all ‘p B1! E-l=I-'-Ill lfillil 1. the fulluwlng ugunrihed vrorartr. to wit: which appear an be figitinag _ '.I_§:f_Q1"| Mid :1-yptngrlml fin the lam! hln-Ii jg-I'I.n_t1l|£ an ,lu.lpm:h letlmrs 1 5 ma Autumn!-.1u-(um) 5 MM Ansrunltiflfl 5 HH EXPE-I14-ed casing! .21 cal. semi llntunltic Putul. .22 ml. inmuunitiu-a .22 cal. Ezqseud-ad casings fig? p1,.;:.§1 uma. flashlight Ittlchafi to barrel z1ur¢¢£.. Elundsuined purtiun uE :1-uI:11 from any Ind lrhitn III’-T1‘-I'll spurt lhitt. - 'H'.a11g: gm! identification Ln name of -daceauui ?)c1.'|'I.. STEE- 'Ee11I:rII' gab tuxi kqyi. 313:5: Rxecutiungr tyjpn hound with circle and email an I-Ila. Lnrgg 'h1.I,E.-, having bllde Ipprnximaltelj 1'2" Iimgth Ink! 1" Ilida Hit]: loaded: hnndla with Inn: brlll rivnti an III: and tape lrwnfl hand-la. ' 3.11:: ilng. 'u3I.J:a:' 1:3-pa been, :13: 10-~':E.. ling I'.LIldbI.'gITl.Q;t' tfpl jlnknr. I'II.:h hloodlclinl on Inns. 2. 1- I.-Mute-ti -t: the Suns»: Trails: run 155] Santa Kan A-rmue, Santa Rana, I::.n11:Ea-I.-aim. said ttlilul‘ in lnclud Ln-I1;-Ir.-1 .A.-?. That said triilzr 1: unn-eruil. House Ttiilur, califi-nrnil L'I.:uII¢ M7 5155 that 1 sh;-d :11: ndjninn 3:16 1.21111: 1.1: npgco ul.-I. Stat: an-1. California. 3. -iuzul ca-was within :11: prmrillnu oi l:a1!|.:EnrI1!|.-I Fnnll I-'-D-flu Stttiuxi 152i-: _ Suhdlvia Luu 1 (5'|:u1u1 prnpgtty]; Eubdiulxiun I [P‘r.1:rpa'l.'I:j|' D1.‘ Haingu us as I. mean: or cu-unltcing I xeiuny}: Eub-'dI:I. inn {Pm-pnl.'I:y -nr : my in evidance Hhich trend: In ihmf I fnluny -eon cnllilttfidl fir flml: a partirrullr person lurl :|:uIu.[|;|:1-d 11:.) ' ============================================= ./texts/FBIZodiac1/48.txt ======= - uhich yurur *1 ' flecifi ‘that ha- in snr%:s;::§o*:lE£ an rra:::m-.nEPo1i-ea 1‘-'e1u=t=nnnI=- - - £1.-an §u.ns11t:'I: Imus fiflfI|',!-- ' I: ' at EFL: film". '-i":'§i-!a:"e:u=Ib1-H aim-lira"?-"11! “flu . * The fan‘ §£f:_:t¥ae;t;tcm:r}tn_ 3:: bunch. -- ., - ' - . 1369 11“; fig 1,3 nsaigand |:1'J thn Hvmiciflt nH—"-1- “1'"'- 9" u¢t°bEr 1: 1“! Hm-L sfflegfi ; an; :3]; 415.132 nu fnund murdered in hi-I til! I: in WWW am] 1;-I“ Etgegtfll San Frmeiuea. That PHTL 5-Iifll .35.!-'5 “in, -that 1 9 HP.‘ :11: its renovated Eran uh! I “Hum 111,5; g, 51 mi njjijtg nu ream-:1-ed in t a tad. cab-. that I Win“ .5 ‘the 5:” ma ulhita Ittlpa Ihirl: which in ‘n1-maintained and I-hid: . 5:3,:-_m was hearing: III-I torn Off ll-14 3*“!-“E 'h'“- ‘:1! 59¢? ‘"5 £“'m“i* ‘nun: an nazéabgg 1.5, 1959 a latttt in "rt:-I11-'1-II hr tbs Edith! I1 ma 5“: frgnnigcu chronicle. That 1rI:1tar of Mid latter claimed thlh hg'I|r3n the ntrdgrer Of the ball d.l‘l1"E! F-551; 5:1-NE. _T|l-H-I lflfilfild in! “id lgtter was a portion of gray Ital Ihita II‘-rill! cloth I131-Eh Mir! Itairur. That lihutlfiorf El-I'll!-1|1_l-'F1Dfl of [#115 4:1-nth eitlhliihtd 111 *3 he 34.3., “.33.,-1.51 gs '.1ni'.:-.3; from thg 1111:: of dam-sued PAIII. S1312. Ihu.-_ fuzth.-_: lnhm-aI:nI:'_|r Q-.'l:l£|1iI1-HEIDI} MI-ti cumplfilun dstnfliflnli fill |t.aj_nn mu, :gi,d. cloth to I19 human blood, of the nuns H. Igl dlfilllfld 5115:}. that Izhg wire: 1:! uitl latter I.d.:ntl.£l.¢-6 h.'l.nn1£ u EHSIAS. That : total of 11 letter! h.l'1|'I been reuelvui 5:111 FHMIIEU; hllnju and and Angela: Dl:'l-|"l‘P_lDQ.I'.'l Ind by Attorney ‘£11.51: tun pnsluazka an and letters Lndtcnca wailing, ates run 3 31 19$? :g flsgdq, E2. 1511, [lat yritgr ofi salfi latterl idgniziilu hlunli cu "’2‘.13I|}LLl.l:+"‘ =';h.m: the [mud 1:!_I:LI:I_n in all. of nu let:-an Ind uwelup-In bu been gxagfinas! by ur. questlnaed Dommanu EII.m'I.illl Uith the 5I:l|:a;.D.:|_uI'|:i;m¢_n't I: Just as E:.l'.'.‘l:. in Sactnumtu. 'Ihlt in Sherwood Harrell‘: u.-pert D11-inilirn all and -emrcln an Inn! ilnlttn Inn Ezintgad by tI1E lama person. '1'Ia.al: 'l'rL|:Ir OE Ill-I3 ether! let fifirfh ‘Eh! nlluwlng ininzmati.-qn in I-lid 1It'|:I'l.'ll . That ha used .1 flnhlighi: attach! to gun barrel to II:-Ht I‘-HIP‘-I-*3 in-1.m-er: 14:13 atlas at uni ht. That he tutu:-and to uhnat the 1:1:-I all I Idma}. bu; pad "sham: t g kidding: 1: they -come bouncing nut." I That he has rnlpurusflhle in: Hue Eallmisla; murdnri -Irlfi Itliauptirfi Ixrflats: ' - nligrliflql I::a1£,EnrIa1.|, flztubgr SD, {DEE Flntiu: Chart .3. I-II:nI Enltmu Calms}, nI1':-II]i'E'E ID, 1553 'I.rl.n:t:ip;: Jetty Jgnnm Ind Du-M tartldly Victim; hnglqgg. [gr-:13 mu! v.1.1.eJu. unsrm-nu. -July snub Hap; count s tlubct‘ 11 1359 - -' " Incl-.1:-I.-. E55113 Ehnp-urd ::ur¢i EII: rtlnctlcro, Dcbdlnhif I-I..‘.l.,. 1369 Hath: in! Sun: ' aI.£fl.o‘nt 51:21::-u that ‘Ella nzurtiurngd uurduzl Ind attuaptttl Iurdurt true can-xittad on dt.I:¢:l in-iicnceai. :hat the oiiunlu in Eulsuna County, 'J'IJ.1aju, [,'.a1i£-,'n,'n£a and“ Iinpu-1, Qgllfiunlia Hgrn [avers I-ID-E nu: nr I1I:1.1ut1r.-rut. . '- - - ' Th-II: I180 includad in laid letttrs -‘IE1’! tea-in in the int‘: II-I gfifitzfitiflioglggvhm Iittacltd urn;-aE raid t:;.-3-ptugrnm.-3 roads in J? ‘-‘ "i'w""' ============================================= ./texts/FBIZodiac1/49.txt ======= ' ‘ -_a"I. _11‘I-it l:!.1:I.$.ng people 1:-a«::.9u.I_I'- it in _ma -mb_ '-Z I I _ 1: 1: min tun than 1:111:53" wlldlgahe i.n_th-3 :l91:o'It htolaflo I ‘mu: 1.; thnrnost -Eaagernu-I animal of -I 11“-:3 g. 'gm;a1-n:E :'|u'-1; pE|:|:l'_c:n| of. 'I:I.IIO{lI'Efl'f.].‘IE-d -Iii -dsl-bill-EH ' nu; arm; I;gra'[:onl:ni.1:Ied in -an Iattorn in rum: nit“ ananttttu himself as 5'3-‘.fi1M‘-_. " ...n. I . _._.-1 .._,.. . . -.m.= .-m::;.iu'.:"n.-.-trig: at-=1.s=a'; that an nu: lbw: JLL1: 2u,'1m, ' ' ha Keceivbd 4 little: Em: tho I-Ls-nlu-ttan Bach Pollen Darpartntnt iuditntin that a. 14:. had :2!!! null ltstountl nE Eodil-II-: Ititlin 5 San Fran: n 199:! ti oontnot-:6 an concerning I- acxlib a sun gust. 1111:: ms July 13, 15?}. 1'1»; afflanlt |:aI1I::-lets-Ii Ibr- EB: tafiaphona. I ' - . _ mm on I-landny, July :5. 1511 the liflanl: m~n1.a to Tnttnnvtat, colifofnil what! he terviavefl rm 1: Matfilu oi hulinan .._, Ea omit. t .'Itn_ Itatu as :Eo].I.o=n: . - -_ ' That he residu ‘in Suuthetn California It . cnliim.-n1.n_. '£htt_he Iotmaxl tniidgd 1: Ban Framtuto - 3.3. Ihat ha ha; ltnwn I won _ he ldantiiitl II JJHIIIIII. I’. 1-EIIEH £1.-‘I.-Hi fo:r"o-rt: tune years.‘ That his tttoo-Gt-Cl college llitli. ktthaurt .a.l.1o.n'I ?1’£I']'.hI1', ~ That an or II’:-out Dgcqlnhgr of 1'56? by lung In thmjllqn hang at 32 Hanna Strut, ‘P-l1Ie_'|o,, California. He is positive I.-hat thin occurred not Lalint :han_..I'onI.In!.'? 1 -I963 humus; hg an-vqfl g snuthueu ce-11£urn1- an January 1, net. 1.-Fm in In.-mm. ma. u 1. u 12 Fresno Street Vallejo, he was engaged in n. nnnvuntinn with .!.r|:h1.n.- Leigh .M.1-an ogout hunting. 1'1-:31-_ .!u'.'I:I1uJ,' Lalgh Align Itaxtgd n gun-. ‘variation about A book which he had rufl calls! "'.|!I:u Holt Ellngcroul Bnnve" 'I'hiI':h concern: the I:I1.|:I1I:I.ng of Ian. _- That Jlrthut alien ltlted that It I'I:r1.L'.I.d bu grunt Ipm.-t to but paoola. Axthut Allan um: an to that-,t1.b-e how you oulfl cult out ‘dttimn in I-overs I-me -trot! It night. Attloh I iiulhlight to I am but-:1 Ind shout than. M then Imuld be no motive the poliltl could nu-var cat:-.‘h jrrru. You could than In-tad confining letters to try; police. Alan 11in mentioned in this conversation Ihonting thg tin ='H I II=?1-991 Inn and nhnotim; the kids is “than; an handing out." Mlln rent on to Itqté that he had be 51:.-I'.nI:1:: about 1': in I loci; tlilu. Ila shed I1: would call Liufifi 'gmn¢E"| M; gun at lituuu told 411:: thol: ll: Icrlmd-ad chuduh pr nu-pm. than I‘.I-ntaln-I mg-:3 Ind tom 9, "I dug‘: up“ what 3-nu. "1-°'|l3:3-‘It limit it I long. tin: I that‘: that tuna 1': going, lflun Inn: has that own an nu.-.al.l.-I tan. hi 1 I! intend‘ to Ilsa Atflnlzliii Itrgnge. - . ‘ 9-I-E1!-HE ll-‘tad if hovlng Ind nun account: ibau-L finding H-l3J.IJgI he may Iul-Ir: lllotutad nid nun jcemmu uh,-|,¢h |._u gm. _ vnrntitrn -lit]; Allan. In stun that thin in nut an an. 3. ¢.|_n lII'=l11 Eh: ournvtrntionu E: can retail. at: on tau :1 ma 1: 'P‘='!'1'=1"I 3-11!!! H!!! the I'll_E!'|'fl-HIE! on outlinad. IE 1: pmitin that the date oi -aid 1m-.J.d:rnt was b-efora Janna:-_r 1, 1953. :I1¢'It.It-u that hi! W315 tllti-fr I‘-I! Inn-q under ol-th in on-art. - - ,.""flI'1v| tn Iain... I11: I11! thlt so ogoin horn: 1|. Inn in gun; . Tho: hm-_'k mud in 7 ' ' ' ' It to the guubglitr of Ivétti ltiflfl Ill -lfljfitlmagjti at In: §::|:-'|1 % and 11-m Irith hit :1 E In an at ; [.7-811fnzn1.n. Thll “ is 3 I:-rtllega g1:.l:Eu.It.g, Ian-1.--on 1- _ ,1,_._14,,__u ——-I..——— —.....—._..-..-—' ——.1.....~J 1.- .. “|¢.'. , ============================================= ./texts/FBIZodiac1/50.txt ======= , L -at ,.--ft = F -- ma _ - ' I that ' - in‘ I "1rt:}--t-.-rl.l.d- not ' %."g§§§§§im at :5 D! !_a‘l.a-_lun-i-I- . . .. ' . ' .- -rum: I-:1.-9.. ‘W, sister-ring-1:1 fit‘ A,|:|:J!|'L-If tun.‘ ._ - E.L1:au| Do1.1a_I.d. Cheney I lfe :I._tI:115.ty. - - . -. . _____. _ _ __ __ _ Hr. bratfier Inf Arthur 1-e - 2-1.!» :1 "-I-1-Ia nmflifl '. re :.a§:.:I.In:_1- stating thst"i£a u-$.11 Hill? to .; - - _ you are belie-v.u2d_Is1na tn ha t-me.’ - _ -- :7 ' fiat the investigating Inapgctara cam £l.nd notulterinr lath: on thg P_l‘Et of Donald fl1gr1gy in maicimi Itatuugnt tn pelltu tflflctrniflfl bu tncntetutmn with Arthur LE1.§}1|. an 1:: Dattmbtr, 19H. Jhifihnt I-u.rtE.:r'd¢u1m:-c": 'II:H1'l: 111 nus -net Lutttn which S.-=hn:ItI.£:r '. |I'r'I.l:vtt' as zodiac and -cinch mat forth and dqtnil of 1:i1lLln5I II'E:u I-In-I-I3 liter January 1, I965." - I ‘[11:51: the Investigating flfficgri in thin cult nbtdnnd txmlplltl of ktthut It prinlih . that laid um:-plat! ‘FEE! wh- Iittfed C.I.1. !:|'¢:I.'mI-Bfitl Eutmlnur. . That on July 29, 1911, tfivllltfl that he had Wwirtd axe-Iplata with the I pent ttttrs ma that said prints.-ng Irma not ths_ II-nu. - T11-ll: in further invtntialtim 11'. Ian learned that Arthur high -Fallen is left .11nnc|-ad. T|:uII:_a_u nu child ha was made to urita Idth hill 1715111: hand. 1.‘-but he luau is lmhifluttmu. That: on Lugtmt 5.. 1¥?I., at 11:lJ|¢} 1.|£'.';' fl.'I'pa¢::I: and Vallejo Police Degattmsant I'.'Ihl¢1.'v'I.EIla-I with fit. era! Supervisor of tin renter iralleéguietraatlan Iltntt. Hr. Egg;-3 he hat Immrn Arthur Allan | t flu yarn. Sly! he Luau: 1:’ Ell to have prulici-Ezlcy in using both hand! lull... . E: knot: JI-.1:r.'hut Ihnut: H-eapcna Hith rufitian . Hr. g Itnta.-G that in: the 133': DH! rtflrl. .h!=|:huz 11-an had twght up it-Mt: cut in E-¢'tl‘I'E!'9Ihl'DlI I115 he 5:11: that Axthtrs: .LL1|-.-n Ind In 1.11:3:-all: tha- Zodiac tilt. i*l.'I7.}H ltited that ha had lgen IQ-Vglfll, gun: in thg limit of Arthur it can altau-ad thus to In .12 calmm: rm-ulna uuul at I-nan: an: automatic. Hz. F tat-111: that :.I.Las: on -an that N"! °=‘=-Hit"! ldmltted ta lbw! E: with I 3:131. light: Eur £l.I.'l.n :I.n than dark. Hr.” hated that IbEn.1.t 5 month: I 1:, ha and 11!: Vlsltafl l'I.'.'_'1:]lI.'l.'l.' Q11 It Align’: hang; in ‘fl'.u,l_1_g_'|u. can m:::gl_,I, fig, ’ 1'6:-I115 Allen bbtalnin hum I-Inetll hm: -lune 1-nutter: -t:un- -3 H E%'Iawra1 pages of legs? tetrtinolnggar uh! Ie.-Mrul page: of tin ' . filth: lid l hi-:.I':cE tndsi nr crypt-t-1;t'::nI which [were an-Mu.|.‘.l. to both -A I. _ - Th-1": 011 Mlsullt I. 19-T1 It llhfifl cm. the JLfl11l.I.ut, with I‘fllj|lII'—I5£|l.' Ind Eat. at the III! as nun lhpaztnut ' tn? l.:l::h1:£I.1 um u11._1n, tn]. at-nu. . - . 1'1-it hflhll “-1011 “Ind ha ttrulfl not ntall having. lmll the . ltlhumnntl attributed can 111.: by H 1.1:. 196?. Min nuts! in It-5 rand chm Isaak. “the Hon: angu.-aw wt" in um um 4::-dc. _ “tit-'-‘I 1|: “H the hell: thing. he had run! in 11151:. Sthnul. lrtiuxt mm “Nita 118.335 SE15 lhflrut tht End-'|'-Ii: II.I.rdtI.'I It the ni=_-up-tpctl but ' «.i§1=E1' til! 1-ni1'—'LI1 rattling did not .Eo11n:unr it in 19:31:, gt it ill tun II=|‘:‘D:|-ii. Later in inifi: interview, Allm ti-an llzqti 1% ha yen" in Euutlxgrn '5-I'H-513-'l:II1I in 1.955. Ell rupuuis I'll “fun out shout thn unnidu 11111-HE-1'" That info-tlnatlan on the k1i1i.n.g In kivntiida in 1565 ltl not -"'3! P1-Ihllt I:-nt.L1 Hmrtmbet Hm. - #11‘-‘hi-I: M-In volunteered thlt he Bid. been quutinnad hr;r | irnlluju 1”"?-13¢ 5'-=rKIlnt Ifttr the mriar It 1.-the Berry-ail: in lip-1 Dainty. iliillina =H=~=une-:1 September 2?. 1969. uvnmmaely Esau pm. by hiftj. ============================================= ./texts/FBIZodiac1/51.txt ======= I” *'x -. ' 3, stated on this particular I-out-pun! ha In some IT-0|?!-Q: to I _-11.“; uugd suit Eoint nan: Fart man, Galifnmin, diving.‘ The-= ' - 9:11;: efipla clan: in him than wen I lEl'\l'L‘EE|'|Il11 iron Iraaxura ifllmll Ind his 3: Eu. He did not recall names of said indivitiunlli ‘En telrlttnefi tn 'Ii'a11¢ga at apprsniruatnljr hlllfl pan. and recalls taikin to a'I:a:.£;I1hu: _ - II1-zrrt Jr after he drove into hi-I driveway. Aim Ital: ha Euui nealxin-at-Iurl to infant the Vailsju niiittz Ilmut having has-.11 tum by thin naighhar at than I:1mn"hI1 1|-at queltiom.-d. Alien It-I-tel neighbor I Hr. Whine. dined - 1 real: .l.El.':¢I! he in questiflutfl. 'iH.|.'.'I|.E:'ut any unltiun E rngsrdirsg I- ‘ Itniit. Julian limit the itrllu-ring ltutanentz "Eh-C two in vol I had in '_ my ear with blood on ‘than, tha bland name Iran: a chicken I had killed." '.I.'t.at kn-Mr: writing: 9: III! act in lfififi in lint-lid: it not include Iyi:-n-L cf nirnla tad |::r:IE:l not: can flu U-tits: idmtily hiunii I! again. . t all. letters identili-ad‘ at the lane tinting h ' T"; ammtI expert. pnltmsrted true: 195 thrush __nr ' inc" -and contain laid circle and c:I:1'.Iu_I:|rmhcII.. . -'11:-It Ilut-Lug interview with dzflur Allan an iugutt i. 1.911 It vu nntqd that Arthur J-llden was Inga;-in 1 zadim: |i':£BI!II'1l.|:l'.h bau- tha mlnra "zodiac" nail unit! I31nh-D1. il 1: a uni; phat nthe: Ihtn I1-fluent -lttcutl thlt nan-a Zodiac I3‘-id l3ht'b'Ol. up-put tat-guthnr. , _ ‘Th-ut :at:-t‘¢Lsw-::itat Atflnlr 3.11 ranzivnd llid Ilzgh .. {run his not In 1 tin tmas gift in Ducuhnhnt. -196]’. That In Igaiu. an-ntuted Ind iatetviu-clad by #111! -Hi-Eialnt an 5043:: at I. 1911. Ihnt—n-.1t¢d as fnllbili { . "1‘fllIH‘|‘-"B|}'£.. T IM-I gains. to will you. ' I Iio=n"t knew if il: in innuztnnr, Inn: I thought uf -nun-.iu.ug aha. Arthur Lu A11 ma 1 d1I¢tIJIII'tII".1i:-.I?rIar. .I=uI;rw.1'IIt1an in Deceuhzt 196?. when Lligh nu dil- ""-'""7]~'1E 1'-13 F193. I '5!!! Ilefiflll that he Illa:-xi ‘IE haw gull enuld £1151-ll.-ll 101;! htnfiwriting. I. remamba: my ralpantu, I told his I guess yuu nauid :0 in library um-5 fig book! an writing. examination to £t.n:l out has writing is id-E.I!LL'J'.E ." , . ‘Hm: lliii-Int again naked 24:. an septuner I 1312 II. Ed “I0 Gfifi-lilili E 315 Ektilllectiun nu I.:unve1:IaI:i|m Irlth Alla. {Int Hit. in pnuitivn ll tn the It-Itnnultn and: by Argus: 34.11;: In. Dlcenhnr, 53". . ‘H111: I .12 Cllibat tutu-antic 1nd .21 caliber tanuuitien itln-\I hi 5-“ 'hW¥1-''£ 9-5 3‘-EH5’ Jflilcn -lad David i'1r:-nl.:3r.I:Iu:nnhnt 20‘. 1953. ' Ealnnn Guunty. _ . _ . - _ ‘that I. '! H1] automatic and 9 1-11 I-nnunitinu Iru 1.1!:-d -in t-hl-lI1BI'.I‘:'J.tt. cl Du-1n_nu Iirlrln and ‘an '_1-nly L, 1559, vnituja. , Th-It Hm In-1!.-all ‘:11 ' y ' " ' “I “am 5 ml ni§a“mdemD£ pfi:h:;na tgffll _. suptuubnr 1?, 96?. Ihtk I".I. e :1: grain tn |.|.nm.. I..u.-go - ' 5315' WV‘!-|‘IEB3I1IIflI Ippmximlttly naive in-than in imguh. one inch iidu § W°°d'll1 '1-I-‘M1 Ill-I‘-J31 I-“I'D bran rivnti 'I1l:h adhuive tape on I:-In-din. ‘.|.'h-II: :- Iuzp-ect _I'U:'¢ 'I'1I13 uniku: :3-pg beau, 31;. 111.51, _ -- zhntnsimnuc :1 ud9rn{mun'11"" cd‘inth‘ki1l : _ _ = uf'I'.!LL'L -in 5-aufiarngignu, Dctuger 11$ E35?‘ gt‘:-H: 1 Egr-Elm néns . 5 P631 51IIi5.'- 5 run: was torn 1::-.-n um um: the killing. 1: a that . -i Eéfifli 01 HIT-E5 Shirl: have been tateivgd in mi}. ‘Eng: 120 must; I-"ht! -If Mid Ihirt are still milling. Ihat walla: and id-Entliiultiun - "“' “1"*"‘ 5"’-'3" 5119* 310'”! ‘=5 PHUL 5'“-I55 hr I1-lip-I-tt. not ‘III’:-ll'1"t1'l!€L -"-yr” - .5- ============================================= ./texts/FBIZodiac1/52.txt ======= ("T In-n-du In that Ilri. sinker-in-Ian tn Jh.'|:1':l.I.r high .LI.1u:. I'll-I-II_ - I118! Arthur .:II.1.’l.a.n mm 1-3.! as 11-911: in his house trailer It thn 5:.-Lula: ".Erni1tr Park II: flfii 3_an':I- Man humus. Enntl Rosa, caliiorniz mu! 1: - _knmI'n to keep I21: pguomtl pzopezty in sauna. - ‘lbs: III-Eu _]-Illtllfitt at the auntnt Trailer Park. l'I:I:tlI' flu: ‘Arthur Allan J. ho-no trails: [united 1.: rpm: A-I‘ in nu - I ‘ Q - -gm: sugfi war; him Irimlrnslar mu J1-ékgt 1:111:11 pa:u‘ub1; um . tr! 11:1‘ 1:-III-lo -nu: M:-:Iasu:' Lei. ‘h 1:11:11 Inn: flzlflnl in I Uniwezul Haul: ‘halter. I::IIl.1£u:-nla Iinannqa E3!-I!» lgmlted at the .'§-anus: trails: Part. 15153 5851! 3.9!! Aflnue, San-1:: in-la. California. Said ctgiiar in lonunul In I «In A-1'. Ihnt Allen 11:11 oI:I:u.pI'.-n.I I shed Ihicla adjalna u..1.d trni Q’! in Erna,-_; J.-3", _ The um:-dnr of rM.1'l.- ETIKE acuurrad Danube: 11 1969. ‘Han In: urtlnn of ram. s1*n~:1:‘s Ifluu-dntainaei um-1-_ |I-:5 .a.i;.d an :-«.1-ma 3.11:. the nu an arm Danube: 1!! 1955'. indicating tlnat the lulpnt I:-n 1-ncalnad : main :1 an uinu. - Tim AH5-UM if-=111&9t' I 3-H”-‘ch 'H'-Ir"!-‘I-fl: Eu Inn: in: I11! purpan GE lulrthifig I-I1I5 Universal trailsr, Ilcgnsg MEI 535$. In-I:,u§gd in ‘PR1! M? It Ina £'ImI-at Trailer Pan.-1:. 2-as: Slntll Eula in-onus, Sauna ioll. C-a|.1.'.Ecru1.| and nid adjahing ahgd L“ 39;“ 1...}. - _.I‘ Ban Francine fullnn Dupxrtlunt linmicifie Detail. Eu3;II=-fibm! Ind Inn:-rn ta but:-are this“; day at auptmbag, 1572. JFJJE5 F.“ .-'C'.'.':5. J!-'r_ "may: at u... Q ,:.“5- ,._.,.,,.= 1”’-"1i“=1°=1H1 W31 teatimunr has been taken at the time -3. date 113'=‘E'iT1 11151!‘-a'=¢<1-—in <=h=mt-ers—: rec-mi ur which 3111 1:1 1:11.; due course or tige be prepared filed‘ with 511 dpfiments ha;-uh. :- -35)’ 35-11193 E. Jones, Jr. ============================================= ./texts/FBIZodiac1/53.txt ======= -4 . M=._ I‘ - _-Fi-'|:'J.I-|fl€-IIlr.|_EyIq:i&'r_I X. .' I? .3 ._ ' '_ ' m L 5 '5 ' -. _- ii:-t¢IIIII:§b-:1-'h'5::uir.-'£:' _ _ i : uachur-nnguiqgggmg - nmau-pea‘-rgj-uulsomauiar . . f_ _ _ . 'c 3‘ t. : '- isnu use " - - - J"_..a,_-_,‘-_.-=.=.-3-.;°'=;,:=:: ' , 4 4 ============================================= ./texts/FBIZodiac1/54.txt ======= 4-T60 [Ebz'r. 5-11-~54]: - nmxxf FEDERAL BUREAU BF DIVESIIGILTIDN FOIPA DELETED PAGE lI‘i'FDRH.tl'l'lflN SHEET fig Pegeis} withheld entirely at this tocatic-n in the File. Due or men of the following statements. where indiqated, explain this de|Ietitun_ Hmtefient were nude pursuant to the exemptions indicated below with no eegregatale material at-'eiJ.e.i:-le for reteaee te ;u'G'r.t. Sect1st,tI_§_é.3=' §.e.e11ee..flA El nut!) E1 IibTI«(7'II{-4) El {dIIl5]- IZE {IJDEZ} El EHJETJFBJ E! v.‘_i}-{2} El (rim) :3 mimic} El [kJ(|I' Es‘! it-}{?2I_-{D} El [k)t2‘I' El tt~)I:‘t‘}IIi-E3} |'_‘HkH3J E3 [mm-r1=’: Electra) El M43 III tr-}{5J IZJ (tits) I: Haiti) ' El (EH9) ' III -[ir)f6}' D {bjffij |:i rem} Cl lnfornletian pertained only to a third party with no reference no the subject at‘ your request. Cl IIU.FI11'mel‘icun pertained only to a third party. The subject of you: request is listed in the title only. '3 Wfivmeflfi ‘v"l’5$J'“flt‘3d with another Government egenr.'}'{i-39-], TPLBE dL2u‘.'I.t:ue.J1t3 were referred to that agertcrlfies} for review and direct reeporu-e to tau. 1'-‘nest contain information furnished by another Government agencyilesl. You will be E|i"55B|1' 13'?‘ 51%‘ F37 33 la the reieeeebility of this inE'orrrtatj_tm fottuwing our com,-ultafign with the other agency-{jes}. PEIgB[$] Withheld IE9-Stmuch as a finer rcllsase determination has not been 1;-,,ad3_ Ygu y.-111 be advised as to £213 dialghilsiliun at a later date. Fae-15 were not eeneiderert for retease as they are dupiicativr; of III For your Lnfonnauion: _flTI1=_=. ft:u_]J.cwritLg number is to he ueed 1'e_r_ 1-_eFe:-enoe regarding these page: .5-=2 r F— 4 — . r =1 - e m ' it nmmzo PAGEIS} it x::-we-:-r XML) DUPLICATIDN rm»: 1: K:-D-zx:-ti-t K FDR nus use 2: BHEGEHK 3 mmxmm PBHDUJ ============================================= ./texts/FBIZodiac1/55.txt ======= _ ' Memorandum ! . 7.. : Ks-‘{’5é2_£5:SF-_??5¥—$¢"?)m géggg,/;vf'g___, I Még»-€44/L.’;:e':av‘ L fi&,F /3f£m.»,i&5’£ ’?7 «¢{L«&d£»an¢«2'LC fifiém/mm '7 ' ‘R4/£»é.c.Z5?L$.7z3az.'a77*"'?C£""“""""“}: 5»? - J mew ">émm4‘=«= fig £f ‘=l-'56,!-'£«I’L.{.¢£ 45: away ma £536 -57“- f="’%’+‘7 4:3 ‘I .;;I5545 arr — §‘:!¥+-’ 7 -4; ============================================= ./texts/FBIZodiac1/56.txt ======= 2-2:-.4 [_R.!v. amgaaa .":.F d inn T-at: EEH.-Vfl I L SCIENCE SERVICES ACCO?-L .H|3‘EENT REPORT bvc. ...-.. new fihfi i ‘ “O4 [:[ E’-aecip |:| llamutie I-‘rm —_ Dam of Activitan "Fl Subject . 4% h -354 -Ease Assigned Tn: Program: |j1=.1$'sn.-mm: gjm.-.mm-= Inst-ntfiaan Prm-Ideti D Filld Elam.-ul E Fanflkj Dininpmull Sludaut Cumualilg ¢¢qEa'I"=|.I'5trninu E Ga-amltatkim |:[ NH ktdnh E] NIH-an-M mm-mr D DEA E] in-Edam’-ct D Pre.-pvutoilun E ibai-I Fllring E] Sympulimm 8 Sn-Ilia: EM-ewe-at Othur, C] T-up-its D1} lI Insfiucilun Raceired D In-5IrII1'|:| D Nu-u+I'B_II O'I'.1|cr:~ CHIS: Descriplinn ¥ Hf -Ehndanh: Dis-tributiau: E - Frontal: hianzgerffirigfnuip k - flat: Egg;-p i:-‘isn- fibll-Ifi 'a"L:IbLlv¢.. Unit Member (5): |:| flurnu Total Hours: rslflufl-‘UC.‘P b-I-L‘!-"nILi¢§' ‘D 1'-'I|!=IIrr -Edrnfiti-la, ET AL -ma.-n-mfs) (:3:-Lu,-A--Ina); t«-M-ram-n-: mam *°— |j3s1:s'.U []B5s5T.r flaszaa jars FELLOWS jjrit:nYG<::J1:=5IIIItf-tTDH-8 ilwutizalire Q cauuimsun .C|PmQ.| Fg:Ie:nI.'|.I=.1I yuuumt ictilin Tskn-"Run Dlnbervl-31' 3&5!-5:7 Elfin: -lr‘.1-aha! ‘Sh!-.'u'ndI:u' hnalrlil Eq,ui'm-all nu-:2. *i'hr-at Anaurm F51 ..-II gf"\?‘.¢5n. 5 gay maintr _L [H 5|-“'?W5I _.... '1I"I«C.i1" j:| Batu: Andra Bhutan Project ENH- [21 Main: U wear m.-_-m/ in j" ss=-my LNA1-‘!'5J$ g1'ELIrHo1~rJ:c E-H'EI'l"TEN gun-srrs RI-search D QURNTJCG ijfinpubfiahalgi Pag}I:,|'E:.ndscIu1,I'E|:I:, DPub£:alI.ocn [.a16e|y'3oq#:_f,EP.L] Dfififilil Runafehfihsaéwk Ufiltfiflb Iunrrhs Ganlulh.-Eta Jidmilistrnlile |j1.':!aa:in,g |:1m-warm: [j Limilwr Dflidd Support D Daudullsflnn U?')‘4l- 5-Irvisn Gamnlhflan AI. 1H3 U O".l'E'.BEl 3 /9'.»"f»'=="?—* #3 DJL-ra::’hu,n'!lnnsurcf‘L-artlin Dfiunamfimu Snap. |jI'.'I:J:I: DPayr.'h. -B-lrvicu flmmldlng Ecfifigfl Iffliflilfl Ufilfllkhfiuq IrI:i.iIIn¥ Dwuaalllar D3-AI‘ Bflcfluhlflun P Computer Support CI?!-'|=wIfl|fl3'|I’ Dina. Analym DWJLEI Dndflpluml flfiauflnhn E]"I'!Isb|:|iI:al. .l.nilh':nD|- Enialut Type ‘Travel Time: 73' -Hui gran sm-wt. Ijn'-hki-91n1.’|.fidcI'BI_ _ 0 FEIJDUIH Ejfiw-L3 5| Fenia- DEA -p mum ============================================= ./texts/FBIZodiac1/57.txt ======= Su T‘-1h-‘I.|'|.R'§|:". {Rh QAIV 1 """*- E A I fir-v-»#r1~=-t L?"i*4 "W‘Fflu’mWT I-|-1|§.3Q'||l-l§:F5- 94 ‘P935-5;__,J5 &,.gfi:!'f_'r,£ A~|=_/:3 gg-..-.r=~.-=-..e.aLs.:;«.-..1 ca: Pgkggg ¢=vu=-as-tr‘_ar Ara;-it-4.15 ~_..._:..-u:°»L Em-lF'.fl,§:-.9-:3 2.:-am-Ac. K fig.-1..-4.: 3.0. 3gp.g.;_.-.=;-fig "r".1'.‘:* IJA-M. 5.5:». A»-Lu. '§hA‘;fl&a-"I-LA-$'|-n:“_?-b. -'. _'Ez.-::e%H :¥Hfi ' $3 ¥ Flnirlilrnlnbu: 0‘ "'53 ‘I ml nun Jhquuuuvn; Frum: "“'r‘?-£1 R;_:,«-~im,..-. —.s5g1z<’— _ an--rnl-r :3 2, swan: 3J.i'i'.uA<:'. wuddfusflulfluntvct w....».....mj_ r....».....>.m.=;—_ OrlflIt:r‘tFlafln'fllIIntIr"'“-“-‘ '3 -*¢‘t‘== ' ’~35“-l W3 % m ============================================= ./texts/FBIZodiac1/63.txt ======= Lm__l._._w,,_. 1_.,;J;. I-k'J_l‘1 “-3.: Es.H3NTJI2Ur-EFIUZ TCI 7BSLB3i?6‘c1"r'?E‘ F‘-'33‘ ' 2:194 (lbw, ujwflj _ ' ’ ? all-I»-..nd1z.u, scmwcn ssnvxcm Accamrmmimznr nnmar v To; _ fnaux 11-=1"4E‘lj_a,. Fzrear. ,2s2E.—fi¢f‘a”J"? ' L“; Tnreiqn |3 naanum [3-rams; [I am.- F1'flI‘|15 :'Ja1e of Az:|:i'vil'y: "'1-I “"l't""I"- _ Tuna! Hanna‘: _1___ sumac-‘=1 Z913-.#\'~'.'." :'.''u-:»'. '55? Case Amiaued “"3 ;_ Unit Manner {:12 fijasmu E-3531: [jasasa [:|ruI.tcx 1-5z.I.aw—5I gnaw 1?€BGRDl1i',u.-fins P‘I"EIgr9.II.'|.' D REGBARGH B '1'.R.lJfl’l't|1|‘{i D TUE-KP EFCHN-HNAI lH'|.'$l“bc.-\.'rt'i-‘E D D-TEER‘. AHILTSIS E] TELEPHGNIC E] WRITTEN E: 031'-SITE S QUAHTICU Iasu-action Pruriflai 1:1-reltigllive llnsurch E] ma Mum van: |:| Ununbtin-.-9 P513-!?.i"HI-IdunIJ'E¢:. Pnulhr flura1o_umenk mam Pubfiutsm {Ju-t'nc|:q.I'Bn-uirfisu} SI-96-rah Gaumufing Fueflaaslirr Lueemuufl E0:-Inna: REIITCHIF-Q.EBaIfl'lI.i£ Gitsfiga - I2‘-nufimu-:-a,|‘EnnLnar D hr-ulintih ’1‘admiqpu luhu-virr C-auuulhminvn Inna-war Shana-,-,r Gq-|)|:alF..Ik'u:Iu1 Rn damn ’J-‘rill Slnlenr I ' , E|N:1'iwuI Ag-ahqwy 1:] '1\u=lim-or Adrallislzati-ri Q38-I Ljfiflnz Arnirfil ijil-stint |:| -i.aur&-.r'Elman.I'I.¢m:: flIfl'3IrI'5at 1}-nth |_‘_[PuI1&i:s.-‘T'nb1i:In- 'i:|'Dta-u17mthnau1 Coop. |:|Pz-npmuon |:| Tjln-It Andgiaia |':‘| Liadspa Emma: ___j__-__ ijlah FT5D‘fi'|¥‘ nu: ma suppers DP:-r=|1. swan Cwuqflng |:|SirnInaIium E-in Vinim _,__ Coaualtu-Ilsa cause-1 Jneid-ml l3un||.'fll¢Iioa I:j3P‘"H"I 3‘:-r-mm; E-‘-I Eu-'n.1~e:h _.L._ Farah. 3-£I'h'u=.II ca-sum: Jadnlqflt 'i'rb|J3'-Julia; Damn; D J: Snaps-:1: C‘-nun-1|:-lil-Eben. flaw '1-‘Mic: Ejflt-pruiacrtiaaflmnbmfl D VEGA? 9 Dz? 5l1H'HI'm1hI E] Mr. .-mu-ai: can an In Si.-p-part C-‘fihval-I“-I-than - Pmrrwmfim E_|}I-Isl:-be Du-ta mm; 9 1/ Law-etiun Recgired s_m...n.,.:.p..,.,. E] IrI—3Ir'H::u P:-qj-.-:1 flmumnum gum-rm H-Ir! gram .l.nd:l.-nee Prnfilng _ Gui": :-—-——-a—- D5-°'N Tiara] ‘Fun: Class Dufliaflon in 91 madam: jfi Lmkzuctia Eu-urn: Bradnm T:-7|: Dfllnem LE Efiun-LB [_jF5I bunt D Fohlp firs: 9‘d'FIpaH um Dignity Hum D Nnflnul As:-Elnn' Erflflhry ,1 - Prnsram Manger (Origins!) l tn Entry - "r ~; 3,. Patina: SE’ new-.: -z¢5.,-my ============================================= ./texts/FBIZodiac1/64.txt ======= I1 750 [Rmf 5 J11 mi] _ FEDERAL BUREAU OF IFEVESTIGAIIDN FDIPA El-EJLETCEJJ ‘PACE INFDEMATIDN SHEET I Peige{s] wilhh-31d anti:-elze at Hula lclcatiun in the file. flue Gr more of the following- statements, where indieated, explain Ehjs deletion. E Deletions were made pursuant to the exemptions ir1I:1'Lr_-‘ated betuu; with ma segrega131e' material available for release to ‘_i'fl'l.L. &_=a.£ C][b}{l:I El (1:-)iT}£fi-J _ |Z|{-1;:-:5) Eiibl-£1} El rzbr-min) El cm: I:I-{M31 ' Q (bJ(’3'III:C:- I'_'1tk:u:t} E u>JmI:I:-J D mum El UIJCTIILEJ El Em) C‘ EBJETJEF} III EMI4} |:I rum:-an El Units; El term El (tics) III IBJE9} El Layne) El [b)E6II El {kim Cl I|!|1'IEH'|!|!I,E.'|!iv:2II'. [:uEH=li.l'l!d {I151}-‘ til 3 Baird part)‘ with no refereuw to the subject of your request. Cl Ififfifmfitiflfl Pfififiiufid 011337 T0 5. third party. The subject of‘ fun: request is mined in the title: 0151?. El Dfitum-wits Oligimiied WUJ1 fluatller Government agency-{i-as]. ‘mess documents were referred to that B36-I:L'-‘-'§'{i&5} for review and direct twp-ynee mu 5--;-u. P9993 C-‘flmfiin information furuhhed by another Government aaeaacirfiies}. '1’IJu will be Sd‘-'5$BIi hi‘ the FBI as ran the rela-usability of‘ Ibis infnrrmesinn Ea]1owing our gun.-,u|t3:jgn with the other ageugzg.-[iesj, Peg-2(3) witbheid inasmuch as a final release datenminariun has not been made. You win he advised as to the disposition at -a later date. Pages wean nut cnnsidesenl for release as they are fiupjjcgtivg gf I] Fur your information: EH3 F0110‘-‘Fins number 1'-5 to he used for reference regarding these pages: ~=é'5=‘»‘uSF-‘Fe='~e£47- fig; ~45 . 3TflGHXH$ K K DELETED PAGEISJ JE Es‘;-Eflfii END DUPLICBATEON FEE X XXIQXX K FOR THIS FAGE X EQFKTCGE DHEGm mflEflfl )'B'[fDOJ' ============================================= ./texts/FBIZodiac1/65.txt ======= --»._ lvremnranniunll ' ~ n. sac, am mancxscn {zszn-33- cf‘-H‘¥'?; nu: 1z,rs,.r:94 [SQ 11} 5I¢'f°='|-' ZODIAC.’ - SERIAL KILLER l'IEW3P.RPE'.R ARTICLE Attached to and congieered part of this memo is a copy of a newspaper article frnm the Sam Pranaisco Citnraninle, "T2115 world,‘ May 3, 1994. aditiun. This copy will he maintained in tha 3525 aonzac control file for infarmatianal purposes only. - 253B-SF- gb,-9'7 {ZODIAC control file} [33 1* .. .-.-.\._ .n. _. 1,. ============================================= ./texts/FBIZodiac1/66.txt ======= HE. no . Ednnfinfiau rum, . uE.m=_aA_ y. __ . _H.._...u._m...._..fi m 3.53? ============================================= ./texts/FBIZodiac1/67.txt ======= E. .______ 55. E ___%a___ a§__§__ =5 3:23 am _._z_______m mE=__. $2.5 ,fi,i=_:= E” .¥_E:.:..§spsule.§__Ea .£E.._a Wa_§ar3_ ...,,.:.Eo5$.d.q.1n=Eq..,.3.E=on..m._.._.:..:s._.a.»._.._.. m._:9¢qi<.HvHaaz+5nva;.uma.m.¢.H1u?.u:€F-a $9553 _.§£:s.u._Ku_a=3..z_c.§=a_ _ .?aa_s.a.s._..z_aas.ss_ 1 .33! _§.._a.._§=_.1 3._:.w.E:3.33_—§E?_:_smfl.__9.= _2._.£.a,afi a s. u. _§:§§_§ias..§.s: fi.§,fi=n.a,fi=.fl_.fi_.§ 5LEE.u1§ E.._..._..z=..r 7.. .333“. £335 . ass. .23.. 2 b. wflyafiafi SEQ. §E_.:..e.v.i_E§..nE¥n§-nE__3a§._ as E Em mama. _: REF €a..a_EE_...,_x3_§. H . 9 E E :3. . 2% E. §m%%.«m &._2._§ 5.332. a... 1.2.. 3335.332 :3. 24:5: : 53.3. . £5 3. 5.3: 5.. =3. a§y._§3n_r§...EE9.nH._§._.sr1 =__._=__m__._ _5_._z§§. . _=_=_:_.=.m ,s:__a=_:. £..._%§.B§m_§.q.fig,fii§wm¥¢n,§_,j.n.s., as 223.. 2. .3... :3“: U" SE. :._§_L _, _. f EazSas§§q£§:.._u=&_ .a...fl_._fi..s._.. =_E_fiw._¢.%.w. r _.. .E_y3_5l.E _...fl_.8-r . » . _ ..§§%.H§e:.,§_,hfi.=h¥§ §a.;..Es.§. . _._!_.32_Ea$uo&rni_._.2fi....:#u9. E1355. fi.___.__a. Ei¥.saEE1._¥_=Ea.?5§.nE£. ___.__.-._.__._u.....? u§&—§.§§u§3LEEE.fl._»w=EB.¥ E: ¥a.E£S_...a :5. 2.8332433. _ =_____ _§__§_ _ =__:___.____=___a . 3 7InI'lAI'|‘rI-l'.II:.u=II. ============================================= ./texts/FBIZodiac1/68.txt ======= Igwnnangln 1 i unmnwmnwaou m.n..=un.ufl..m_a=.u . fl:._..mR:.F.nEnn: ._mEh2_%fl.__unn_wnH. . m?.|.En3n_ efi._:sfi_E .a_3..H.=...E.m_._........ fl.._..fi?.hn__§ .u_fl._.nnm3».....nh.Rn— ._a§S§§3. E5... E5 _ ..§£$_E_. ii . mB.nuH=n.n_=...E.n.u urn . 2a._E_.eE.fl_. mrnssnmocmzwé uuE.manw3Em.nmmfi mfaraaaas .s+_u _...w=nn_ 52% flramefiww. . . . .su....n ..Eé?§sfiyfi.efivaaa 5.zfi.w.fl_n.¥%a.afi_,fifi . n2_§.:._u.9a,._._.e: a:_..w..EnEnEnu3. Eaaikaerza . . El .,:_&...a§_ . fee ." . __..5Ei apu::..xB E. Eu. §.EE§a_€..a52.E§=§EpaE9. fi1w"i§.fi.mnpgaw3fi,§i.%.w..§§5ss.fl__g=.,.u%§ fifi.uesE,%s,Eafi§.§.5.fi Hfifiafia .§.=_.a__.Hq.sa.5 .5... .3.a.s_ .I_.a_. ..._.B..uuB_a.F_u_.lB33. .__¥__aEEn_.ui._a9.n€3¥.DE fifiuflpfidfiififi E5a£E:l:_§,_x_i2E. fiflmflflfiwfifigflfifi #sEEa:as.£.=rn..§E_ anauh E.saE..HE-.g_§un_n.E. w._.....r».-...w._.n..w.“.._m__n_qI_.,._ 4...: «n.__=_..E.5....as_...._ 3au£u§Eu.F:&u.u.nBg-..a.¥.wu. l3«a..xu.unfi1_.a_Dn_boa.. .z __E.£.23_§.E.u§a_.: .._ n.._a.E.nan_E2:§.r£auaE _.§.._...=u.E. azuwfi. $.._s._...._. .5 wSs...a_._._EaEBa.,..3 .E.E...=.:a".nE:n3_.:._hka5 . Ba._..EEaP.._.wBi!_s. u=._E1.a=_....:» .w%r.m.n.§_..=w._w.«.r&=..Erfifi Ei..sn.Mn..E§q laa3..§a.au..3.. n_a:pE£§m..»sE.E»en_p...nmrr fi.__.na.nEE53¢EE__.E§_i.u:. :....__xn.anE§as_EE .__..E....§ a:.._£E.___.E£¥.E...E1_§ss E¢._..apr:§.__asrEhw?_E ask . 5:. . aim. 2 . n.fiEEfiJ§=....h.nE i€__flu ._=EE.an5u.Es§...s.a2zE_a§a a.._.,___9§n_ E.n=_._..a.m.a_wa_.._§ ___u...2. _nI:aas5a.nE€:raa“.n4.a.wnE§ fi,..:z5uE_.mE..z>:n:¢i£a._Es.. u_..H.._E..__..m_ _a..E..:_m.__wm..n§_zE. E3Ec2&.r.u::__.?aa..§es¢:nn...!d >._.._w_wm..§.u..¢::.n..H_u_.a.,..I—_.,.:vn.._.:a Efifil .E._..Ea§ «...h,...Efl..:.mw_1Eh.u..___ _s§.n_. =.__.._5.. . 3. _fiaE.£.l§3fifl_s.a.o.25._uEEw«.v iK§:g3Eflnw..fi._a..p E2553! __._.{lI.uluI§... E333: BEER... vi, ....aweE...§ .E.E._§§.___._S _EE:..Ea._....£€ .=E.lEl.E_E.u4 wfl!§H$:wrr_nw.E:a...E.us3£Bwumu.au_. .m..x£....5 uP_..E.un._o_ :o..3..uEwu.e._._.a mifléku-u?£rE9EFHai3um..nE9P.._$ :x..&.a&.2.. :tE_l&:..mE.Ru5§a 3[..uED%:a«.mw.J-wufifl.s:.§g.uhu_”L 5E azu 3.3329 Ia. e.E_Ep.a...:.._.5r.__x_.. Egan. l:wr§_.Ln$.E...___.aEe 235.. nn.:urna§oan...r:_B_u..._%.. 0. _u.. ============================================= ./texts/FBIZodiac1/69.txt ======= . "».a;1.fr.".m*"a':a’:.!~.*r.:.',;-:-;.';'="°''*=“°°M°* ‘Tl {mum -HNIWI-I ‘II “I ha‘ -H-W ~‘-‘ES-E Fa E 3 F%%Qm§ a gay‘ man‘ vlrnmnm '°4J2°l’DMW-um1flwIIw n roqpud:-rung lW1'l pwflw arm In J-‘M Ivmd am am Elsa 'l9l|l.I‘l1 . ‘ w;'m'HuIuh-sci “I ‘W51 Wmnmnmmmm IF‘ ‘II-‘-'lFF¢l0‘|I'rl2I= W4-Wmmml ll-I|1-‘m-1~;IE|zc . . E =. ..sea ___ _ . ».a!..._sBnum.E§p=.a._..§a.29§___E .___$fl.hE»EW..u9nn:.amL§1fifi.sn.w_aam _ _ _ .a3_S:._._z___... §§§5§.t§EK g:5. 55.? re. 5.! . . m aIl_n_£.uPn_ ss=.§.ra..:§5.n=fi.._v..fl_n.3&fir_n...h . ============================================= ./texts/FBIZodiac1/71.txt ======= ..,§a_.,....~. fix. _.¥m_%naa.E.fia% 333 Ed: m.ww_._%mB_.._.__EEmE an Eu PM? man SW93 .. . _u.....m.,.au..”_fl __n=n§......awU_wa_u H,mE.H._unu.a»fi...:_uEfin_uF£Esu Ba.__m§dm.a.E_.fi .3: aamfiifimnemauafifiyygfisumfi. Z...En_u..Ea w.S§.H_uw._._nE..._ _.n_....fi_m:E 8 .m.E.E..?.o__m~. mun Eta... Pan ..._.._..__ u...%.S..___.o.rn_.uu,.._.. d_fi9.E.n. .393 > E... I :3... __ 5.. 55531: .«:...S.u.E._n anti .5 a.a.$fi_..,§s_m.:¥§. fimEuE::ah.,$._§i§s=. 5 .4 ... 43:2: 5 :5... Ease _£Els..§1FE.E.aa.=EEuaa;:.w_.._ _§puEn$§5&.Ia.u_=a_:a!.§_F. —F£ an... n .25. ..z_.__%~.Ea.§Eu1.w.:..5e.. _ . E323, az.2§oE_._._.a.§ E Ese;.E.__:.: .. 34353.2 11.... E..9g.B.n.mfiaa_i.E=:$ =_....¢.$s.rm» _ _.a._aan ._.E_r.fi._____ ._§.an£ _E.__.a¢.._ an .2 _£.sE.,. fl,ws.firws:.H._«E_.u,imau1§.M Ti. .J=__w.§E!s..~%..uM$3§5¢_. .2E..§..a.e:.._a_r?._.a3uru .:&%aiE_§_§.3%nza::s:EeEaR .i.._.=..a.a_.E.£Ea .:..a2_E_u.§§.. .v2.;=s_}uEu§£S...ns3_l:E Ea.Fs._Eia.r=Es.ucis§5E=._..i9n :....__.£_u.._..._..%.___».u_.§ ._B=2EF1_s..=xE E.a__.g.§.!afiz_E3.E5fiS_EF§.a.. 3.EapEa.a==8.€: .i:....§§_:._:... 235.1 ua._Enwa§._.u..a9.n¥.F $...u..oc_._z¢ .Ffl._3_¢.=.a&....a§:_ tn: uhunfifi lg. . E 63.33 .0: _su53.5.__.... _.3n.Z.. In ?§fi &Ea...u.Ean2..u.k.n_.n..%%.v_u%sfl5£_.u»w._m¢u_W.r-M 235$ :39. 33. 3:15. :.,u:_.._ 3 5.6 ._E_a.Ens_z....,.l.¥..$Ei§_aE 4._.:.2.fi.E»£QEa._E2=fi2uwR.v!_s.& §: 3._._.§..£_.r__$ 5....:....i.E.s.u.%§Baaa.E .r_::§_..u.._. ..u.£¢.._n.a§.a....E.§.n9ah.._.Hn§__“._u.._§ #5. 391225252 55.? . E sen . 3. gur.fi«.g€$.M£1n$_uE¢.Ea§i.aTB.h.r F+_..fl.?.|..m%oFm.w£E_2. =25. 3v.......u._uo.m....a.._...:_......u.xa Hanan gang! win... _ {Eu 3.: 5:32:23? 5| .. un..mmhwa..n_unpsfi._a§.§ a s..n....fiuL_._1—,.E.&fl.;I..,.u.__..:rp__._L_._....r§:wEh miuqfim.-=BE§¥=rua|om«é.__u_m...m:w%¢w§.a .Eaz_§x9E2:._3£__w5u.§.m.:a.E P=.mE._...:..2iu.,...n.:an__nw.fi a.BE2k_.n.uE§S..$E¢..v_z.E.s._.§E_a. 3.... r%..:hwn_.w.fl.zm.fiwH$_za%$ _aL.iS%=5h25,.._-rfiutsa 4:.E...r.B ..§§_._E._.§.5$E.§.E_..=.ese .5. E..w.._u.Ea a .. w:a._.§E.x&_.EE&:3._=.i§E..&. ss..__i_.§... . . §.H2E....E=£ .__.u.aEn:. §BrE 35:. _ a.vs§___E_aa 35.93. 2%. ,..§§§§.E F_a§a_g..w.._,;;ms.m... Efifi.,whfiwfi_..ha?sm§su . s ...E_.E.9Eie.3§...BEE fl.s._»uH...e_m.. .+w.Ea&Esm.an..nw:%_w_L,. flmw?,sE::.a?.?=_,..u.§§_.E . .u&.e=Sfl_s1su.n___.n..._§:. »..Eu££.s.§§t_=.§ws§.n.§a_Ee . .a.sE.aza}§E._.2E?..§E _.Eaa4aH..a_¢.mn§.....:_a.n :nF£Eu._a..u§_._a!£. . . _mfi2.Pn.§s&§].aa¥$a__..§§r .3. RE_p&.§n rs. E51332! __§E._§SE.._.£3..§_.E §§.n.n.5EcE§_rB.aEE5£Enw: _.E.§§E,§.?.A#.E_E:sz..§:§ _U.uIEcu._u_.Ea_is._..au..l-n.§;6§BS..?nv . :...._5E§..p x_ .3... F§sE§...m,_.fis_ __.rs5_s:.ar;_.:.a==FEi __u:..aE_u 55.3, .2 out 72..., ss£E§.§rmawixF...£.-3233.. rain 3 . 915 Eng? _n=... :___fi_s__,_fi 2......” .5. _§s§___w.E.§1..§..sa.E§_§ Huufiafifi .§fi._§4 #5 _ uEi.zB._F.t_..E:u.&nsac.ra1r:311a_ EL.as2:.uaos._£_ __.____.u._ .a§...__...S._ c. Hetnlpr-u'bu=e\-nu ============================================= ./texts/FBIZodiac1/72.txt ======= '1 1 . nu-rn|‘flI'9du'nfl»md um nunm: u»m:‘a:n.I:-u:.L-m:u1nIrw:h1.mu. PUW1‘ “”“1"l'|-‘“-”°““lP'"" '°'||""|fi1”l war ‘;awWhW n anm-Ihtannonu U III I'M" PE In ' "3-|'m=mPw:::wh1-N kw ‘mind In 111 hf-rid :»:"f;flkJ‘I1||lWl‘i3ZI':'l30'7£IrF‘IJ"i?flIflTDf|}fl We-n . _’ . '-w°wm'm=Iw¢mm'M “’*F""|lo1I'l'I|'l'F"'fl"""|-'F"F-'“'l'f""""F”°'|3 -:1rI-M:amneo- wan-Ih1'-nun mwmwl In-pm -Iwmmmr rm 1 mm Wm WM -nu m - -rm mwa l'W§|'Kl nun n£I':urI'avaI’m 4'll.|!'1UT|3l'|- wmw-hi-u-an-sun -an-on ' mwmkflm $6»: nmuweu mwwnnnwiwnvm ‘mm vmw-om mum;-I: mm irrrlt-IIwI»4'§°&$ W1-Iwfir-rwc-Irma a emmumwm Hm ma we-ma gwmmr mu mun f-‘I'iTld]I'9‘l -uu mmmmwwgwggmm _ mwaaqmmfi mm - ‘ag_ri:iE.p4_{.1_=M-au} w-... - milifimwifi CI‘ - -'|?'1“i‘F'*'5 u ,1 - mm[anpamm " . flflfiwflnaufiwa "* ':.In_.gam'mddB' ..‘.'T.“;".'.‘i3?-"',"1‘?§"'5‘J}!13' -:3'71'-'7;-«Wei whmrqggzamn: wmmnuW M.p§fipm$M " ' I:-G I-Vt-|.I'l'l|'l.Mk§¢tIII.-&Iu>|n\J:-1-\a:I\:|'In.‘|,u I :d Jfim hua II-Iwdhrll-'l.n' :mf"‘==|p=g I 5'-h'N||'ll'i‘-l§H|"I-|¢'°I iiqhlilnq ma -"‘-'\"3I|JVWWI"flI'|" N 91'" Ill-H ‘§%?EE§§; E§§EE~ §§%~%%§§§ §§§§§a§? @%§§ E = E E§§§?§:§ §_§§i;gi -' -=1rr.fi I .. .»_’/931% ;'c’gc,ue + cL£.:x_::*zfc,g£p€ =~ fim 5‘ .-:6 513/ mic: /r;.wru:._. --élcwyflgxg ag 44% ============================================= ./texts/FBIZodiac1/77.txt ======= 54C» 524%’ xi:/Mme; ;..........—:-—awv—v-w--:-—»—~—-fi~-A--'-v-adr-4-.-.. iiaiaff Q J" :25‘? .,=1%‘.%~”%J°’3~545 /:2:/gfiix flaw ¢£.&r:»cw1,c,,1J2.3 I Ad {,4 ~ gig; {i%fl‘r fg/;—“%*’3‘14f.e" .7‘: Jalw ' @/%:;M, Ma -»*€»**'5=3e?J aififiéfiéér-;,«=»‘ £51 Ji€!_;fii2%‘;¢>3{L3 w::>n=é.*r,»-:£_ oai¢»£4i»£ ;¢:Zg,:gfi»_fQ,.3,,m., Wk flu ‘/m7‘£f”L ' ~ d£.¢=C47?«&€Zic£S Vgéy 3%‘/0036:2430 ============================================= ./texts/FBIZodiac1/81.txt ======= 4450 |ReIr- 9- an 943 FEDERAL BUREa’.LlJ OF INVESTEGATEON FDIPA DELETED PAGE INFORMATION SHEET '. -9’ Ps:ge(s} withheld entirely at this location in the F13. One or mom of‘ the follow.-1'_o,g = statements, where indicated, explain thig. d,e]el;i,or|., M Deietions were made pmeuant to the exemptions in-:1.iI:a1:ed below with no segregable material avaiia.1:|]e for release to you. ‘o 551 Se ' S23 I:1u=Jc1;+ E1 Ehlfillteh El (ante) El (hm) . III {hlfihtel III 63(2) I3 (Int?) [3] 'I'|='}[?}'['C} III [will E] tan;-mtlzrn CI{k;u:2:u El I:h}m-(E3 Elnora: CI (b}['J'J{FJI CI {kjteij Ifl ow: CI (bl-{S} |:I-:s=::rs:« III note: E1 (tow) |3(k)!-S) CI ta]-{5} Etk:-(*1; Cl Information pertained. only to :1 third parttr with no ngference to the subject of your request. El Iufecrmetioo pertained only to 3 third no.1-t3,-. The subjem of your Iequ-3.3! is jtsmd ‘tn the title only. G DDE1-'|fi‘%Eflf-B 0=I'i.§ifi9.!:-Ed Withl Enflther Goa-eruoaeot agate-_.-[ies_‘,I. These niocuments were mvfttmd to that agencyfiiee) for TBVJBW -and direct response to you. Page: conIail1iufom'L-atioll furnished ‘:}3_- another Government EIgfl_1Jr_‘)rI[j,e_5:|-, You will hg 5d_'\’5Wd bi‘ 333 FBI %‘if"3' “$3 ffilflfiflbtlllf Of this ioformation FI}11Dwio.g our consultation Both the C|‘tt|.|B‘.T age,u,c1_.r[1es:I_ . Veggie) Withheid ifieemneb as 9 final release cletesmioation has not been made. You will be. elivxsed as to the duoosthou at a late: em. Pages were not -::on5it:1ered for release as they are duplicating or Cl Fer your information: $1.115 :Eg1_Jvo?s':'.n number is to h-{H1353-:i For ref r on: regarding these pggcg; A~:u:-"<—32—’=-‘r’ 4- ."‘fE’.4=B:_T 5DQGmEQflQHflK K DELETED PAGEIQS} 5!: HFEXFDGC XND DUPLICATIDN FEE 25'. }§}‘;'X3‘DCK X FOR THIS PAGE X 3-.'}{X}GG{ X3‘£5C3€J{X3C5{D'* "No - '- -' '- ikI1u=.ai:' shunt" --5*“ I‘ - E5 ' _- mum!-umhaucwuxwm mm, . I ]_ . . , .- i“u“I __ leaflet-l._ I .- . “}-h“'F“3l:r mmr..w'Bpm.w.[tb”'I 1”’; wu.1.s.In _ Adhur Aug. he are-....'c1"’..".ia.-5’§?1"'..,‘“~“E"""‘°’a""‘~“ “"51-esznmbol "-5§‘:'§L'”“ “hm” ' 1* ' .mia-cl-emu-. " °“”"““” ‘_ fligmlswmgutalgltufiumthn , DmN.I'hu.s:nLu[JI.hkfl.-I! ¢at;Ey1n;_-V IrnnlI:J1‘3I:.'flmJu|,m,!IA" _1"I=5wE-aauchudt-mm,,3;,d_ +Jmm15gmu:1;urapmh'_.m¢ sllaojuugghugm-Inbe tllu|g:~Jl.|.|.¢ujua_-as . -aha:-51' nun, In 8115!’: I -.I.W'*'3|1. '-R53," ’ :fL:""‘.:*:°;r's.§:*°*?.:.:°";.m- ':13.T£;.“m uumwm. -w+=H=-mm -- -as - was Ric-P" ' 7"|Ifl==rI1'-allanuma -. "id-flI55%¥mtL_;haI tlvlfiflrqid.-ad his '“‘1:f-gnééaagerhuwmmuffubfl.‘-1 ’”'”""“'?'E'“"?’=='1'-i. 9‘-Hain Iuhhflh wmptu ." “IE5-W.'a'I3.‘Ifinnt. --M-“USED 9:99;] : 1:am1Baiat1:!EEnd59e1fi11.er—»thIbpumdbm3£r?iewrIaqoaa15__ 7°‘ Tmimh “"."°"'F"P3~ LnEm:n.oI.waqxIan1H.U.u:rw}n-En T}'E’-’dDd.|an9h5nu'p'u11i¢5|3,-__.1mi" ui r-I " .: _ Ind 111.; mung: gen-amt-vm "339 but-we-an 1953.39. Fsw q.;,- . '9.» “U an-mi ihE¢lfl1!1:pP=P0c21?-'%‘1bbai.l!nfI:aDE_ *1 5*‘-viii nun: WI‘r|:|:|gn°_ B““H_flM”;°g. Ibuahiaid. "WEI! ' ""I'kIi.ada:Irac:v=:1kJrrizI;|Ia.'a . . llav-m1-‘Mn-slut E.‘§'.w:nl‘B-" Um 'u9'.¢1'T!n.Hl$I:1N-"'ItfI an interview ' nlomflbjafifieutpgnerxfiqlprhue atuspechintluiko-diannnur~dxw\."II] hottest ' - = -' .I"\Dm.5:'|.s.'t_T|1B. and police sum. fltaI!1s‘=_7fi-$iIaIa&£-<1a!v%rjIEviIr1arnB5ra«- J? 1>B=at._-_lhe Enpa lam-é at * gtuxrundaaa-shew ' etl I:'s;.h-mceuca nut _ _ ' _:;se'e£onI.+c,A;221 ' I . ============================================= ./texts/FBIZodiac2/1.txt ======= Freedom aflnformetien and Privacy Acts Sn Eje CL‘ 2’ 0.314 C KELLER File Number: 9-fig-499;! SECTION A Federal Bureau efln vestigatian ============================================= ./texts/FBIZodiac2/2.txt ======= ”§:::; éxsias |:.:'-"pI_p-3-‘ix 3-£=_:'J=J-an or cu;-g!gj' _ AIRMQCII. — REGISTERED __ {:5 V . " "=3:-"flirn_=.-ctor, mi‘ I . .. .. .‘ . -_; A'I§IjEIi1‘IfCJI-1:: :31; Laboratory. ._ 5¢éa¢efi:¢“fs;¢a3j"”** ti; orgginal :::i:1_.'a_L1;,a_;1¢ ' "fDe_ai_-' E‘.di._tn'-r,-" '£I1'i _ emi5'.1;Ig w1'ah'."di:;1_ _ ’lJ1.i's-1et.ter'-was sent amnym .'San'Franci..au:-a Examiner, over to Vallejo Police Ifepartnment, El-.4’-5.-’ 1.251;! to t _ recaived, and turned ' 59 . . pa; and ‘two 1'.- ancis-co .- . Hwménfif Sf-'_e:"welo -_add:-eased to San ,-co tar? . . . y".;.'»f séfi Eréhélscfi th.-I-'ee._p#ge_ 3.3-1:-I:e'r, 5 -is the zodiac speaking ‘~- not get: fit:-nt'..}:nage._—Iéx_: ============================================= ./texts/FBIZodiac2/3.txt ======= ‘ '' s_e i_t.-=_=.m='. he . ============================================= ./texts/FBIZodiac2/4.txt ======= 3 ‘El ‘HOLE l.Si.I'|.N! ifl ’:I ‘cl 'Hfl.1.BllIvI5'l'M I-IO1J.‘I"9iJ.$l.M-ll MI l'IV3*-“'9 '!"|"l|5|'-'|!i EION3tI__IA3 ' —"I- I1 1.: *. sunnu or 1 * . .»WA5mNumH':n:fs3':'_'G‘"°" .—..a:.'a.A'-.rII1'I‘ -1'0 1'1“ .. 1 I Eat‘ 3 U I /f“‘“"‘Efi ° N3 ‘ £1913-9:1. ============================================= ./texts/FBIZodiac2/5.txt ======= urea-can -:12—'!-96] ‘- i: } FEDERAL BUREAU DF II|TESIIGATI|J1'§ EUIPA D PAGE ]NTC|RIi'L.~1'I'IC|H FFHEET .50 Pageals) wimhelfl 6Cl'L1.'i.I'-E151’ at this l+:»<:al.iI:r|:I i.12TJ1—s file. One qr cnom £|f'H1.|3 fu]}I:Iwiugs1aIx:m£n:rt-5. wiuare , ' explain this d.I:l-cticus. H I:Ir21e-tlcrns mam maflepuxsuant bottle-M2.:n11fi,ou.gi31d.icaI.e=dba§nwvri1hms@egah1e marerialavmilnhlefvar re}-am to yvau. I Eigi mum El fl:I]{1J 4:1 (b_‘.s{'?J(;°.]I CI -id)-:5) El {bl-:13 i'_'I Cb)f7iII:B) El {DEE} U t'b‘.Ifl3II Ell [1I}|?'5'II('CJ El {Bill 151 ct»:-mI'($:- . El -:1=)("3') El ltzfoinaatlon pertained ou.‘_1-' to a TJJ:.i.fd -pan)‘ with than Iefe-1'em:=e to the: aubfecl of 3.rm:1' request Dd.’ the -:-uhgieat of you: rsqpast is lished in Lb: <:'It[-3 |:Iu1_'.-'. I:I Df:H=I.uU.Es1L'3 originamd v-1:2: 3-tl-0-fi1.&t' Govamamnt =a3etm3'Eir=3}- These dnrsumeaus was-2 !'€i3f!|'EI1 to mat 5.3911:-“-1r'[i£E} futr re"-‘law 3.11:1 dimcrt ['6'-EDD\1'.:5-9 to 3.-cu. Pages oomaLu i.I:I.fimT.\:Iax'u:u:I fiJ.1\3l5-'cI.:>cl ‘u7a1:I<:rfl1uar Gmmzrnment ag-aA:II:yI(J'.es}I. You willbe adfised hyrxtu: FE] es tu Lhc Ic5::ansabJ'J.1'13' of this information fcllluwiug crur I:-u1:tsuJta.t'mu wivfll. tbs: :h'.brI: agcncjfiicsll. Pig-:(:} witbhuid Luasmucla as :3 fuml relaas,-2 demnuujnaxiuu ha; om been 113.31-1:2. You willhe advlsaci as tn the fiiwuslfinu at a law dam. Pages were not considered for re]e:a:.s as 11163’ 513 duplicativa cf Psgcria} with]:-:56 Em Iht iullcuwing §e>.a$uu{$): }3[ The fie-]J<>wi=u.g number is :0 be mad for rreftremze rreganiin lime P3363: ‘:7 ' 'V‘i'_tH =' I ’g?_c: 'r'-In J? X${KX KXK X ]}¢1et¢d'¥'agI:{.sI| X H No D1.1pI'u:a1iur1, J,’-‘as X X for this gage K XXXKKXEKXXKXXKXK K.I=Z)iI=i'.XX I-{EU-{XJUE K,I_'."DC_'JC_')§ _ _ FEUDU-1 ============================================= ./texts/FBIZodiac2/6.txt ======= ============================================= ./texts/FBIZodiac2/7.txt ======= -.- = = "' " _ _' _._- ' FAJL aonw El 'L‘SL.E',[\{‘§I'.5 |,.'¢1rr I: _ ============================================= ./texts/FBIZodiac2/8.txt ======= ============================================= ./texts/FBIZodiac2/9.txt ======= 09:-1:.I;..2<1-:14-M5} KDIPDUGC .T'C'L"DCF-ix FEDF-FULL BUREAU OF INVESIIGAIIQN FGJTA DEL.ETfi!IJ PAGE ]]'~IF)~:n«:E:- D on?) CE ICGJETHFJ U -iikl-lid} El rt-H4} El ::t:2-ts} 1:! 09:5} El {bJ{5J D it-J-:9} El (ma) :4 CI:-Ilfifi) El mm C! Eufonmaxiou pcttaiund. my to 3 ibird. 1;Iam.r with 1:u:I Iefeneane to ma sutgieacx of 5'oI.I.-r Mqunat or the aubj-:11 I:|f}\o'IJ_'|: Manes: is limd in me tiue nmjr. U Documazus migiual-ad wi1i1s.n.o1J:Ie.I GD'I'€iTl.1E|£l2ll a.geu.cy|_'i&g.}_ 1'hae.& doummu mm reigned 9:; ma: ggg;|'|_c:([i2,s:| for mwfiicw and disco; Ia-mamas to yuu. T H363 13¢-!1I1aii.I1 iuFI:IrJ:JaI5CIJ2 fumifllod b3‘.a.IJcr.‘:‘.1c1' Govuunaent ag,e:ucytji.e.a]_ You bc 3d_\"_i,5Ed by 111:: F5! 3.-, 113 the rel-zasatlilittr of Itli-S iJ:IfDEIU.=IIi-0!} following nu: 4:.cIm1I.1ta.1.1'I:rn with 1.11:‘. :>1i'ue:r aaganc;-'I{ia}. Pagm{-5) wiunhdcl i.|:Ias|:w.I.u:C|1 as aLfi.n.a1 ralaass data-migmion tun. not hath made. You wiJlb3 advised as to Ifie disposition at a. La.t¢r Iiaxc. w... ‘P? I: IF I’-egraarwé nut crunsldcrud. For I:I:]I=asI= aabbry-ms duplicaxlv-3 of q-3'19‘? I 1* '-I ,‘_Ji-G L Q: |. ?.age{s) wiylznhvzld. {oi the following _n:a5:<:41u:_'s}: EU T112 f¢l1c>:I.'ig,gtzum%er is M be used fog‘ mfcjenm :%,rd§ug nus: pagus; 3- n_.;-par»; mag 31 KKXXXKKXQCKXIGGGGC K Dchadead 'Page(s} X X No Duplicsxion Fcc X 992 Eur this pug: K KKXIPDQKXKXXIXXXK KKXXXX HIXKKX XKXKKK FIEIFDIJ-J ============================================= ./texts/FBIZodiac2/10.txt ======= I:§'v;;A._1I;I {ll-3-96] - Xxlflflfi XX}C‘i—.-‘-G‘: FEDERAL BUREAU OF ]N"r'1’-3'I'IGA'I'ION I FUEPPI DELETED Pciufz-"E [hIF{Ii‘IIH.o'-'n'I'IflN SI:|IEET J P-9.3‘-"{3} Wimhflfi -2n!'m21:r 9! T-his lvcaxion ‘u: the me. {me ur mom of the folluwingatabenauuw. where imfibcalnd. u:.'xp]s.iJ1 this deleaion. g 1I|I=JI=f5-U05 WW8 made Pursuant ID the axerinydtinns iuflirzmd bcluw withuo sI:gr@1:'l~= tuamzial avaitahle In; nfllmpc Lu :,rA:n.=. Section 55': Section 552:; III (hm El I:b}n:ucA:» U cum '3 |.'bJ{1) U Eb)-W113») El EH1) U {ti}-£3) E1 EbJ'i"7}[‘3J' 5' FE)-{1} _ 9i {hJI:?}[!:I} 1:: {Lamb _ ::I n=:«r':-ta El {U23}- _ U -':h:«m-(F3: III {tem- n am} E: (95:33 El {k3I(5:~ D mm C: (human an 90:51 E It-3'93-3 El mm: D Lnfiouuaxiuu 5.1-¢|.'t3.1'Md. c|l'IJ:-' DD 3 lJ1i.fi1 |:|3JT,'i Wi1h no |:\*2l‘I“=:I:~=I:II:I= tv 'U|.|'-' 50.1:-_iocJ: of yuu: request 0: tbs subject of :r<:nJ.r :I.‘E11=J.¢51. is listcd in tin: 1.1't§I:. uuiy. El Dclcuamrtis ofiginated with aalomer Guvenummt a,g\e:ncjr[ie.5]. new ducumem were msenuq to am a,gI:,o.t:_j-'[i.<:$] tbv: mviwzw azui climct jesgonse: to you. Pages oo:uaj.n iufunnaxiqn EI.1mi5bx=:|. tI:r.a.nor.h-2|: Goveznmmlg a3|:ru:_-,r[E.::.-5:|. trgu -:|r_'|2[t|c 9Qh'i,5.e{E l;v}r=J_13 FBE as to TJL-3 I-slaasabilitz-' of this infumadon fc-JJowiugou.r nunsultafiuq with aha ¢&u:;,- a;y::cIcy|jn$)._ ':PsgsI§s} wiflthsld iJ1a-:-mu-311 as a {mi release I:1I:!1I:1'|:|:u'J1:a1:i.|:I|:I. has nu: beau; m,a.d.e. You willbv; advised. 35 tu me disposition at 3. Isle-1 d.a,t-3. P3935 wntrt: nut uwbsidmad for release as flxey us: d.tl§}-litafift mg‘ P."‘8\£B|IS) P4"i'1iJ.hEJ<1 fcrl‘ r11-2 1\“<>l.|t:I1-viss.-a I:I=a9wI.{.sII: H The FDFJ-0'-9‘i-11.gE|'JEtJ19=SL' Lt-1:} be Mad fur In:FcI:rm::<: J.'Bg>8.Udi.Dg these. pages: *‘-?'- Ir‘?-fir!» I .fl-rail .3! 5? 90 XXX KKX K D:E:En::1 'Pagt(.s) X X No Duplicauhn F23 K I fur Unis page 21' XXKIIKKJQQKKXXXKK xx)-tux ‘XXI-EX.‘-‘EX KKHHEX . FEII'D-0.T ============================================= ./texts/FBIZodiac2/11.txt ======= ============================================= ./texts/FBIZodiac2/12.txt ======= ._‘_ ‘L-¥'\£ ' ' _.-. ;+wr1teffwho’Et&Ees' ‘ bggeficial to you 1;‘: connectiésn with th;E_ |='u*-¢_a_3.ffi-n $2-:7-«E-|J -Gr - 133%’ = ra.1mI_~nl'.o_ _vli_«_ftI§§"; .,_..-. Tall¢ju_Eo1ic Dé arfm efthh _ ' _ " 1"" h-'a"pe'- 1':-113--|=_3'z'1I::]l.c|-.*:"a:i-‘|:ej.I’5i.‘;"§‘. t-==.- he w'~1=_;-=r'-' «ass ============================================= ./texts/FBIZodiac2/13.txt ======= '—-1‘. » l_,-xbY-c7r‘c|l$'|.'.4_:‘'rc|qh.lI\.§t|>c|_I. Farm _-#1‘ '\ _'w§s_Hi_ur;Tnu.' n._“- c " ' -v." I FE_lJ£"It'.Il. iaum-:.'Iu-"aw 'in«f1.vfi-.'1|:;_:nn'tiIé ============================================= ./texts/FBIZodiac2/14.txt ======= ============================================= ./texts/FBIZodiac2/15.txt ======= Lana-;:uw Tran.-.q;:tta'L Form ' _ " - -72'. . '- . ,- . : - - 1 =.s~*"r--" ‘-“' V-./’ \.I_ ‘- .o—/oaala-A-.1. 1-Annnrrnnr “E“*1-3"'?‘3‘"'-"f-"!*‘E¥J!!3!I'°¥!'- . W ============================================= ./texts/FBIZodiac2/16.txt ======= "_n.-at-:_._-f *3‘ -I..I.30.k.hfI2f_'.E|‘I- -> —"-.¥u=Ie-.wu-'-Ian. ============================================= ./texts/FBIZodiac2/17.txt ======= § axmxeg A'm*rEL ' - " ' J - AIRHAIL .9, RE.GISIERED_ DIRECTUIE FBI ATTN: FEE LABURATGRE "i'=‘1'2'-obi" ‘.3393, S£1CRAifF.3~T1'C| {‘35_f:'}3‘J {'F_)___J TD SUBJECT: UNKISEDI-Ii-T STJE-JECI: ’ ' "“.Fal'Lajo- 'Eimes-Eterald" '* Vallejo, California - VIUEIM " ' ELTOETICIEJ ‘Rn; Sacrarnarlto airtel to Bureau Ifiated E|r'5.r‘59- I - E.-iclg god ‘mg-zawitia 15 an envelope banning po.=s‘t~ anciacoh Calif.’ BI'I_U,."'59,. addressed to Sgt. Vallejo Police Department, Vallejo, Célifi-. em: on mg a 3 2: 5 ca ing a typowritterl note L; beginning ‘Wear 5g.1:. :ond ending with "G-cI1'lCEI'F!Ii3d citizen". Also enrzlo a "}'.~.--;-n-»--.- ,=.,.u.,;.:_ . ' ' ‘ , ,._ .. ,-—.-...\~'¢.l‘-; _ _ _ . - Q“ -*-M;a_n1=-mvin aphitagngpriih“-tutu pi-il;‘l:w_Il }111,i5.‘BIe'1-_.,f . _ gash hsnzinn r _ 3 "_'l_I_ag___ia|.1-.-I::.*;i‘i’:~!-'4!-9‘. T311‘ 1' ‘-"M tr: the -.- '|_!lIfia_I£l!"-I. -r I“ "W ' .' " '-'-' .. -'- qua‘ s..'m'p_.;.. :..g1m1..';* ~'-a;m-'1." of ya-rig‘ -+5 '-n-I:}|$':"- *2 part: of this tip-her lg:-a baing 3:11:34“ .‘'p “T E . ,5‘ QB‘? Pi‘-Htvnulsr of cipher -wan-pansrigsgflfius and Q~c:E_1nt1-.'e'1.- ' PP-El 1' cnurnnazn on nub: mas") ============================================= ./texts/FBIZodiac2/24.txt ======= ¥'hut¢«copy'T"-bf ¢nve1up'e’1puEtIq.a;9c%d' ._”_S_»A1|__'§'R_-Q-HCI:fi.CQ5. -_ -' ' 31_JU1:;1_9i59" he:ar:'.ng._11.-Eng-_.-:$£'i,fifE!d'ii:idz-skit "s."t'-. cm‘-u.-m'i"a1a "5 E'[:i_%':"'P1:.-fljg.--.i2!.i‘I_i_I_l":"‘ 91-gas: Ri.t'i;'tf.'tb-’e'2tI1tc:i:f.“.‘: am:--ash"-riap~ . ' : "main a Rush *1.-'o?£-:¥1_‘t:or". . . .. -. ‘ - ' . _. ,p-'"-.-.:»=.'-2%.. . ‘W531--.. ,..'-1i“-£9’? Hazing hnfidz .. fl%;’is~§£'%:3.'E'I.?;“g"‘§§‘1§‘13 .“"7“’*.“:’. %':_=13_"Ae}-[“TJ<|=T| '3 rk;I=:3:u _ C‘ 'Zh}£’TJ{F} U Mi“) I3 (him :3 ch:-ts} U £k;I~:sJ Ea‘ {b}E5} ET EIIHPZI El {lcll-{5} U WEE} U HEM‘) E! I.13EI:Ir.uw|.i'::n. pcmimfi -:>:1.1;rtn:u a mun party war; no s<:I-:r-mu: to the ssnbjmt afwur raqxua-at <20: Lb: sutnjutt M‘ :-our t’I$'.|§|'l3£5[ Ls listed in tin: ch]: 0551-. El Dxurusnbs o1'lgi.n.-atai Wi.fl1.El.DCITJ1.Sl' Guvaenmant agaucyfiie-5}. The-.53 dommmuus were reigned to um agemyfiee-} Eur n'.'viI::w and dimci N-Epunsc ta 3%. Pages cn:J.ta'L:I1 i:3fumJ.a4iuu fi.Lru.i-sited Eur a.11uI:J:n:r Gr:-vemmml 38E=JJ.|3-':1{i-‘3-3)- You wiJi he asivimd by tbs: FBI as ‘no 1313 mlaasabdilur 03131.12 infmmmtap fuLLnrwi.1J,g4:uur mggulzafiuu with the ud::e;' agaurfiiasfi. D?-‘ggsflsj withizlsld. inasmuch as 9 f.13a.E Ieiefie datuniiuaxion has 11.0: been: mafia. You wiiibe adwrisead as to its -disposition a: a [am claw. =I"- E‘a,1_B:51-!-'I:II=rLf:ItI‘3¢02I$iI1I’:1'&Ii1 forreieasrs as tltejrsmre d.up:ita:3*a'e -:1‘ 9 -".I“9"!'fr'-*;"' l;:_-ups _a:g._. 93,3665) wi1.h.i1.e|d four the iullcuwing IE-$.5DEl(5}Z N The foiluwing l1J.1.'l'Elb%' 1.51:0 be used for oeiarecltce: ramming mess pages: 517‘ '1'9'L"-"' '1': tfifirux '? J'- 3 K I2|&]e:1e1cl'P2se.(s}I X X No Duplication F-33 K 7': fur ihis 119g: H 2IiJi}1'J€}iXX,}§2{K}E§Z§.'JE3(}E PCCKXXK I=E9§HXI'C'i 1’C’iX.KXT't' . FH=JIICU ============================================= ./texts/FBIZodiac2/26.txt ======= rinigji aumu or lHVL;:I1G'_AT[DN_ Weshflyéiun. _D. -3. 2053? .- 1-_—i.I..Ii‘.%.:at'1'_r_.',I='__I_r"_;_»nL”' pm a. a TE_ N T‘. ER‘ P_FE_4 H .T»._ .- _-. ,.¢_ ‘1%:s':_1-'1:_3n_$;«:'g _ 'r_.~.-r;-'.'_tr*r -5:153 ale. _ g‘ ;‘ .. -- '-,‘“'". ..- ' . ' T:-1.55 -aspen" as F-URHHHED FOR OFFICIAL use 030:1’ %EPm3m?§59fi€L$?“EP“U_"E_.;;; . ' " - - - .2 . ""‘7:—-¢-~'--*=--»~=—..¢-.rv-:-.—.---- """“<'a-Mn-v'wouucp—v'v--"dwh:-ur\-nr:>.rw—uunJ—_ -...«._.=.°_n_._,.,_..._.__._,____,.,_.,,__,.,......_,,,,._,._h ,_g._,_,._.._. x... ============================================= ./texts/FBIZodiac2/27.txt ======= . J; H a _ mgr: ‘fies’ J r- Rficggfigp FEDERAL BUREAU or nlwesncarxiz:-nt - — UNTTED 5T.-'5‘-TEE UEFHHTMENT OF J'U$T[CE 3 1? Bianca.-c1ed: 3-19-59 ?:35 a.m. Re-:e1ved:' 8-19-69 ajh up Lccboru Lonr Wwk: Shesat _ _ ' no :43 run / ._ F‘-==1:moiouu summer; _ -. F"L1e -4 '~’~I« er-‘:9 .«' F; F" -'5 .-‘ 1:11:59 Yimns Her!-1-l, " - . .. .. _- L°'='-=*D—B9MflBD59 1-5 "|l'111aj-3, l2aLL:L£urnia 3.EJ.¥ A—10|J42 N EXT DRTI OH’ H E33:-:t:n'L_J_1_c[_tj-C-I319-c[l;lE>5tE:cl by-: s""r%ntn {%_iE} ‘H E_fi_ug 'E"“"“““*“”‘°""‘”’-”’="_'“""‘ haw-mt - l"- E"J‘*‘3-.‘.'5"~'-5""“-'*'-EE :4-an Eu,-guit of Ezcurninution: I 31 ' Estcmniuutjan by: _ I I .. . . 1040 1 » mm W; v__ .-...~_ _- 6?r,,, ;2,'°|' 3' (an 15.3) _ . _ ‘F. ;h""":""("""“"‘-"" .-.~=:~..£...Z', J-:{__d_&‘_g_r _ -5? J.-¢—'-0-A-{I .._.;°fi’&‘\'- " 2p it I ' L; {J ~,__ K . I 5;-.39-.~..:.4.J Specimzlw submittebd for exqminutiun “ .1Th.!’lI had" _tlI.1Itt .,£i.'Ipa.gnhlg:I.nali “In Q Ed.‘ttfl'l'*P.":h‘I.B in Enindinn Is:-IJtin_:.-.1. ." . an iii 510034 -lgtl blai-Elia: "lan§I- I did nut lean than Ian: M 111I.'I:1.’l.':I1.g...'* ' " .: 1-um: ' 1- '3 1:. 1113.1. man I - Q we mififxggsflnimhq 1* High tun Qnll Photocopy at -melts»: pfistnirkld "sax c':'a'_:.I¥ F?! 31 -NFL I.I§I" bunting hlnal ‘W-.'.-l';_£KAi'|3.IH',ER - s_.n nun, my 1-I.t_asn-1gI.I__§Ji _:n mun‘ "- '- -' - "-hi A phih-any if H "hind gait irapnfntfi '-'!§Ill:' £di._ _ ii‘ liiiiau ,__:_ I ' I"?-i-I .~"’._3_ .' - ' . ': _____. qua Eugen: pcgt beginning "Hare is pa:-t at u ::i_p-h-w 1:ha-n-1.-ham .{_;le$‘13I 2 1aI1"‘|:I of thin cipher I:-c being I;n|11cd.,."_' - L’ QIET Phatuaupjr HS cfipher lannnpanying £155 and Q¢E'_1_¢-rug;-' ‘r L3}! __1,Jll Pggn l EDHIIHUED DH P.fi.EE}[=.I!_- '- fififi ----— - m__-_ --m..w.. -.....-._.-.._,L_,_,W._,..._,,._,._fi.._.__.m.,.,..,_,_.,_;,__«-..=_ .d_ n-.._- $93 ============================================= ./texts/FBIZodiac2/28.txt ======= -M.-J " Ge: Phnrtuca riot I'n1Pe1Dp«€'_pd&t_fl.l.1"Rcd-_-"§§H.-P'IfiN'l'3I51GD;.-GPJ..I}Y‘_:PH " fl.-31 533” 95!”;h:aring_ h!fi§"bf1nfi&¢i§5re!i¢“S{3fgLSfir§h£h1_ 35in frun, Cfiiif. Picnic fish-ta.Editbr!? hn‘éfi flip .:.r‘_'!_?§'ll'&l¢,ilil£h tuesdiggr-='. L. . ' ;..:% £.1i9.*t lug . ggzpnln “I_n the ki1;¢r_nf q__e2E Phatacaggr of _£:1;;:;1'¢;a_;-_’I.uf«cs::aa1_,uin3’rin¢'¢qui'?£_I'51§;5-'5;r_ ._x, _.2~ Inga I _ D-EEIIBIIIDSB I-is ..1.. campletesi 31,3215-Drf, IJ1e1;as;ed- - .*1.—-.; agar‘ Time . 6”?" - .. ,,;e_.ryig:errM"3"' ============================================= ./texts/FBIZodiac2/29.txt ======= up-::.a.-11:: {:23-95} , __5 X:-U-EDGE FEDERAL .BURE.iU DF Afi0N FOIFA DELETED PAGE HHFGRHIATION SHEET 1'aga:-9} W50:-held cwtirely at am: 1-mfiuu in Ihr: file. Um: our man: of Iht: futtwingsrawumts, where iJ:udi,c.-a.|:xad__. I:'«.91=:iJ1 this lflfilfltiflll. El Daletiuux were mad: pmfluaul 50 the 1!1U:u:u;II:i.cI:1s Lndicmd below w'rL1-.no scgtegabla mamria] available fur mluasc u:I you. §fiE9.5!:.§§l ' -5533 El ram} :1 ::I=)mmJ D id]-:5: D {W23 El If:-3~I’?JcB) III {nan El ft-N331 El fhK‘3'3IECJ £1 -:1=I|I:1} _ El EIJUZIEDD E1 -'.1=JIi2]- _ El fb:IEi'}tEJ El Iiklrtfi} _ tl cl:-am-(F) U Iiktut-1} El mm) El (buts) n:r I;|¢[fl U fl=3-(.53 E‘ I213-£9) I3 [Isl-{SJ El {him El mm D IIIFOTIIILEFLOJI P33131335 £3611]-'!IZI 3 third paxty wiun no nefemmer to 1J1e anbjvaact Erfj-uur IDC|_lI.€-at or Lb: subjwl of‘;-our reI_|L1I:sl is ligand in the rifle u:1J_='. E! Document: urigmated w'L1i1 auuthsr Guwmmml sgm1c:r{B«-.5). Th-:9; documtxnts ware refs:-ms to max 3g:Ur_.-fin} Eur mfiew and dime: mponsw to 3'¢‘JJ.. j T’a&-=5 C-Jr-Iain ifimmfiim fuslfishad 1:-3r mfltcr Guwrmnwx agenca-'{i=esJ. You will be a.d'-'§9c-:1 by the FBI as LE} the rclcasahfliry ofdzlis information following nu: consxuzaaiuu v.-'rn1 Lbs c|d:|eq' agaz|;_':g.I{i,u:|_ ]‘agB(-5_‘.I withhefld 'Lna5m.n.c11 as a fislal rnlcass 4:'1e.te::I:aina1.ioI:| has not bee-,n, mafia. You w-jI[I:Ie advised ag. to ma dimusltlau a1 a 13:13:: data. ,& Psgcs wr:I:I: not OOl':5-i.d.B?l.'E:Cl for E31335: as me? an: duplicaiivt: of gr E':'?:"':|"-‘ Jr ggatg J’ -L P533-£(S} '-§"ltTJJ:I.~‘—‘|-<1 fur kbfi £0110:-iug rI=ascIa.(s'5: H The T0510?-'i|II5 1J.'-la-‘IJ|:‘2t' law b: usud. for mfmenoe ='aga.nfi.-11,5 TJ1E:z.-3 pagae: ' ?- '+“?"iW- F Fifi-J *1-'5'" KX XHm I Unlined 'Pagt:{5) X X No tIu{:-J3-1;-t.i::un Far: )6: K Fm this gage 2'5 KKEXXXXXX K XIXELX KXIKKX XXXXXX . Fnzrpqr ============================================= ./texts/FBIZodiac2/30.txt ======= F.-'._ ~nunuu., or INL3 Lfifi. Igentsou % ============================================= ./texts/FBIZodiac2/31.txt ======= ‘H Iaenrdad am; V.- BILBIEQ FEDERAL BUREEU 0? INVEETEGATEC-N " 111; UNITED STATES DEPARTMENT OF JUSTICE RECEIVED: 3-i7_'l~rS9 lrj ‘ Laboratory ‘Hark Sheet 3% LIB P133 EECOREED: 3-21-59 3:10 arfidjj Rs: - u-mrr File : 5-49911" LP _. . l1IEIfl'I"H § _ ' Lab. 19- D-5-GDEIEDE6 _-LL “Vail-31¢ 'I'1naiIs--EBrt1d'' * . .. ., _ . Val-Luge. htizurnu - . ' Lc""E‘:‘*"3-'3"-'-'42 TIEEII _ " IHETIDH Ex-Iiniuutionw-‘—‘l=1E3teE| hf‘ flilcfahflflta Agni-_‘_j_ gf]_4'/fig "5’§°”°i=i‘5*'l°1""‘9*1“"?3Fi%‘*£ na¢1men:-fingerprint-¢r‘J}?1L D“? m:"_i"ed:' 3H15f fl; ' Fl:%E!estIlt}JE1E5m::nlnuL£<:un: ' " ..' _b1r.- ‘ . fl ‘ _ o . .{)//JJKTFQOI 1" _”'d"""'£‘°_‘1£ ?J'f"" -W2: -- B? I‘Ic:-ted . ' ' -_"'-5*‘-f.-C'_'.:-:'_A;-LL. - El)‘; "' J:-—-4-. Jj?-ql "q“*'- — -'—'.*<-0 uiafif ¢* I I. I- .-1:-,£_ J:/Lg; ‘Rid W” czar.’ .=..-.1 9,9 ,4? . Specimens auhrtamad Io: e>.r:*-“"‘ . ::j:x--=---- _ ‘ Examination campletad :§=i'];':::7'.=~; 5;f.:;J.5g:e¢7é Di-ctated §§;:~tgE:?_ _ ============================================= ./texts/FBIZodiac2/32.txt ======= can-zxr Iilfi-f-95.! . } ?CCkDDCK FEDERAL BUREAU OF‘ ]}£‘?J(BZI 13 Lilli?)- E1 fb}‘C3J III I:'r:I><'=‘_J('-Z3} II: {km} '\l'\ D Ii‘rJ?'£”-"3033 Er (13:21 _ El mimrm r:| mtg; _ U 1f1:'}'i’:‘3[3-W El I.'3:}[-43! El GEM} 1:1 {t-3:133 El mas: El th:u[5J £1 chat?) I: flcJCEJ {I {kl}-{|:T.| El 0430') El I3Lt'onr1.a3io:1 pefiaimd uni} to a flair-ll party with no mfianemce to the sutjec.-4 ofyour raaqaagz en: the $|.1t|jI:d ufymu; mqnest i.a],iate.d in ms title only. C‘ Documcnls urlgimtcxl with iu:u:IHm Gumztmsemt agen.r:_rI.’jr:s}. ’I‘o.=s:: l:|.u-:I.u:u.u|7:1E H-'r.m: refurred LU L113: agmycarfnaj for revizw am film: I:I=51:-:JII5I= 1:: 3-w. P=1g€=S- contain iofexmatloux fumialtcd b'ji.1J.C|<'J2lB!W Gmnerumazut age:|1.cyI{iasj. You willbe aghri.-aq.:1 In-'1_'h,y;: [-EB[ 35 to flue Ielea-s»ab'LJ.1't:-' of mu iazfomation t'u|.1¢rm'.ng«:rur oms:.L1La.tiu.u with me other a.genc:3-{la}. Faguisfi withheld inasmuch as afiuzral ml-we dzmrminmlon has not lzserm n:I.3.d.c. You wjll be sdvisaad. as to t't|.2 Ifiispuslfium at a 1333: (Labs. H‘ ‘.1 If Pagfii not oomidmtd forruiuasc as they-na=o dtlplicaflw of ¢.- ‘fijff. (L Iggy j P!ags-{5} w'LTJ1J1.al¢! forflte f0-]!D|.l_-‘Eng reasonlj.-3): flmermtomngnwubarumbeusmrmxtsermccm ' Lhgscpagcsi - 4- trees: -5- page .|' XXK.?'3'i3GD{K2}ni9J- El cJ¢[5_| U Co)|I6]' E! [K2-C"-'3 El TJ1fUTU!.St'LG'n pr:'.I'tS.il:IEI2| I:IUl:r 10 a Uiim 133.113.‘ w'L=J1 3.9 zefrxrurtc-I2. on the subject of 3-011: requat or dye subj-em: cu: you: mqmst is listed in me title D11-1fiiJ1 Ltlfflfttlfltiflfl. fllitlfihéd bf:-' 3.cII:I|1bcI Gm-'c1'|:I31:Icux agtzn.-:_1r[ica}. Ya-‘u. w'i_]§l:|e advised by I312 FBI as to we releasabilitj of this Lnfomatla-IL foLlmvi:IJ,g«:mr Dame-u1ta.=_iun aid; 13:»: um: =ageJ:u.':3'Ijivaa}. Pagfls) Wilhtuczld inasmuch as a +1113] rslsase EDp has not 13-2.2:; madn. ‘(nu -.».-§|_|bg a,d_1.-355-.1: 35, to fin; dispuaitlon at 3. Eaxlzr date. Pages wane not nm1.s':ds:n2.a foo‘ (aims: as 1b.I:_*r am dLap1i.c.aI'wc of Fa.gI::{s]I wilb.tIJ:1d. for flu: fi:I§[I:rwiJ1.g nc=awn[5}I*. fl The fo1Iorwi.11,g number ism baused furrefareune mgagdiggg :b.-zst_pagt-3: 6?» #¢=H{- 3 (4.3%; 1. XXJGCCKXXXXJJDECXX X De1eLea1'Pa.ge{s} 31' R No Du§_I]il7.11iUrI Foe. Ti 3 foo-1his page X KXXXXKXXXXXXXXXX }.‘.5s5s’.'X'<'§X .'-*.'}DEX.X2-E KPQEKKK _ EB‘[|'D{}J ============================================= ./texts/FBIZodiac2/35.txt ======= , ' 5 -xEfi ============================================= ./texts/FBIZodiac2/36.txt ======= PAFE Faun; '”_ f ' __v{.1_ ;_ffi5?'Kf£}fH§SifiE{ATED'IuHIHE LdcfiL”EEwS}HFE =f§E'LEITE3é nEc§1vEn_E?_IH£_$nfi ' 'St?&€§fififELE'fi;ii FfiANc1sc§5?E§nm1MEfi§'hun_IHE '%j' E iacT;gE 1 ============================================= ./texts/FBIZodiac2/37.txt ======= " .r-.. __K\__.. I _ a '-,,W_ ms crrv or vA|.|.E.:u:_, ?»(’/5:??? PDLIE1 DEPAWIMINT October 2, $959 .. } ‘ Cg} _ , “"7. _ ’ -' fififlfilc, C*°r5#LF-~# 14537??? _ ’J,_. "” Af1fl 1--\-ré/“:*'-I-4:?’ vi“ ' __ _,-. //r"“-P"-:-"a':~’-a-J"$<-r5!.6L-H-na-I r.2"’¢c'-"§-I’,-§i..4L«:\o»~J=rLr<-=-r- "-.-=_-_- -* _J. Edgar Hoover, Director - -Taaeral Bureau of Ifivéstigat1Dn,. :, _, _ Washington. D-.‘ I3.-" - - ' -' J" ‘ _ _ ' .._. _ _ fla#Q%}!.. Re!‘ FBI Filaafififinflfifi vpn case #243;a5 Atteznt ion Iabora torjr: _ Dear 511:: With reference to the above casa, enclused pl ea Se find; ' ' Q} "E. cdpies éf twu lqziars éénfi ta EH3 3- San Francisco Examiner. 4- S,-F’-: .-_*.J.n..§'»;=:,. .6; - - - - r::~ “ ' ' - ' ' ' b.. -Gbpjr of 1g=_-t1:EJ".‘- -sent the Valléjc->-.--' Times Hetald. .' _ _ _ tihn for employme-n1: ' hanéurrining c. Copies of sin 11 and applica ‘E319 of 5u.sp£:ct_, _,___.._._. gull |. almfimts IEILTIIH I W " .9. fl U. E-‘K! -III":-mm-_. I. will you '1:_u1eas.e have hand-writ campari made of handwriting in lattua grit that of on applicati-:m farms. ' ' ' ' " a B-_,r; _ H5: 5 ;3 _ A? as I In-_ _£E£jfiE_;z{ Z, Enclosures J I "!'.I'-‘.I.I.l‘_|G I |:.HLIFORfII.|'-|. I 559% I IRE). CODE 3'3} 4. I .4 ============================================= ./texts/FBIZodiac2/38.txt ======= ' -_'I‘e:.¢lS-.:§'3E'{' Ioétn ‘-“fa” j'£§Ai= T']I'Elli:EfI ca 53-. ' if‘ I I: ;'VFJLLEJU T Fangs: ,_-_%:_:9;nL;.:1__r;__”;haf1a_.a1:;’ A !'u"i:"r:+:u'_1.1 ;w_".q §s313.H§ - ._h . ,y_%. ,, A;.;_g5.,__.s.':'§ -'Hl'.!SP_I ' °*" '~.-I.—*,:%e-?»-‘. . "War¥n§?*§g'&E:?.'ii:“i*fi“%“pié.;_s.;:-.;- ' ---' --3:; _. :_-"gt-3: raw =.-: =A'.- i‘:é?I=«1o-«'L-'l":!‘.5.—‘.-é?-j;»'_i-E."-t. '-‘= o " E EIE§TIFI_E'D..5?JE_'F §a'E___nr.=E'l'- ' ' Fyri En»-;E:' gé "Ha T_::_Li.;-.;-1.j:_r_rs_§_:'i'j:'gm.- 5- . - _ _-==': Bl':=?}'1|I;'1:’_'1:.-[DH "W ============================================= ./texts/FBIZodiac2/39.txt ======= " ' r": I n: - '\ 13-‘*=?"?**=T ffifi T3.1_...Ifl€. ' '. ._a.._r:u_'fii: J" H ' . :‘;_,_~i—-_,__§_;___‘ .'_.-.?,‘_‘_3;;a¢;:_1.g,:g":T-J‘ 5:-'*'.‘.._;'. ; I-"_n§:sE 1_‘1'u}fi‘lT_S.E:|ETJE1.UP J _ HP?-:~ ‘Kane :34: BR turn: . .-".5. }-' EB - HDRTHEH C¥tLIF43EHIR' . < . .-4:-.-.-.-_,.;.'.»=--,-..>'\_-'_-$-==€-Q. v.-a:,~‘3--* '- I -IE5. .c¢-'1'.;.-._:-' . : _.-a-\. '-._ . _:_ -___ Y HEW3 NEDIJ1 IN $§_-.-'-.;'E'=_-_.' $3: -4. I - ' ' __-_;_:_:1~_:r_I_;_1._:-1'u;;'2. 1'_I u_:-L‘ a_1~gI_s1u:: ,__£';-gr re;'::_r_1E RMEDJLND nnusEnnu's}€a~_ ============================================= ./texts/FBIZodiac2/40.txt ======= 1: ' ==_-s;_c*-«--.».-:_ . ..-'»r.'°‘3«- . 2 1,n1-.61?-xi’ gag” Eh mi " . . -' .;&;:%e£§n1§-E9.~.—~ mm 31*" ' S ‘- -nulls’ . .9 2152" ri:-2 =a».;:::eass;g;:L=:;;_3 5,;§_:-‘Pu’ Kg; MENS L1" I ‘SFEBI ============================================= ./texts/FBIZodiac2/41.txt ======= '-M'-'€-'?-*=*E:n'L§' menu or luv ‘E1:-sAIioH' " _3:-'+. Washington, IZLC. 2:15.37 _ REPORT cuf the “ ,1;-g,;_ IDENTIFICATION DIVISION ~95’ LATENT FINGERPREMT SECTIEIN ‘“::’:"'-:c“°- Case -#2-‘L3-1 flutabar 6, 1969' . ’ W ' 9-4 — j C |-A-TENT 'C:'-\fiE NO. TD: Hx. Jack E. s:11tz{‘k"',_'?,‘IE-' Chief taf Pallei , ’ ' ‘Vallejo. fhliiornia 94590 Attention: fletactive Sergennt_ 191‘! = Ummum SIJ‘fi,1EEI.;~ 55$? _ VflUiJ94.. 151 ‘1;$:TT:»‘rEm:»r-I fir“? 5'-fidiugratn from mini uf Police, Valleja, California, on -Clctuber 1, 1969, and -' 5/ F‘E93"'3“<='='~= taletype from FBI, §ac:*:n:n.snt;-, on Itnatober 1, 1959 E?tAH£tf.A1'|.CIH rI.I.=n:ILIEfi’r?_‘U 6T: 6?EcmEh_3: Addreasae and FBI. E-'aarm:a-umo This report confirm: and aupplementa our radiogram to you an October 2. 1969. '3 7 was .3 previously reported Intent ftngexprinta :‘.: 1-_r 1.- I '-5-"- -' . :15 ill- : may or may not -- same person natned in 1975' your radiugxam. No palm prints are contained in nu: £1123 for 1:l1.:L: individual. The requested Eapy of H19 fingerprints of -15 enclosed. Jo Encluaure .J ' cf. ~' F !I‘|h:=LEn| In incr ‘J " COMM-Fal T-a-|-non UDLHOGI T HUM 95$?‘-av C-u:puc |'-'4'-1l-$lu-_- 52??" -I Sacramento (.9 3 ':.;E-‘*3?’ ., ' '- a'('u-q-u-U‘— - Gdffl '-C" __I. "L ' I Jnhn E.-:Iu € vat, D-lmcbar ;rE: Qfl‘3c/i.m;maffiJ£ -_ _ .-. '1 T .. , . ;:::.%-L— I"; .«-'51,-'n’:a“ REFGET rs ruxwasgso rm: n::F:r._ry::;4,:. 535 may 0- . E9 G-awdr |IHu=_ norm T‘EL::1'P-E u-.u_er1-|:| ============================================= ./texts/FBIZodiac2/42.txt ======= §-G5 [Fl-: n LL.-‘E -E31 FEDEFIAL EIUFIEAU GF ]NVE3TIG&T]ON LATENT FINGEHPRINT SECTEUH WUHK SHEET Refiwdedl EOKZ.-"55? 55:00 g_'_;n' Reference N:-: Case 2431416 FBI File No: 949911 — C? H355‘-i'*‘3d= ].{."."'1;"lE9 zln L.I:iterJi Caz» No:,j_'L_1|:.D,_12 "'9"3""’9F*¢‘= Mr. Jack. E. Stiltz, Chief of P ‘Lee Vallejo, Caiifornia 94590 Afientiou: Detective Berg-e-9.1: Zip Code per Natiunal Zip Code Directory} Exuminutian requssied hv: ixddressee 3? _ K bqb i¢5.‘§|;'[¢: _-."i."':-o- ::-.dr._-; .= . _._,. ?___ If E E5: U§.'~TKi‘iU":-T su:~.~r.::I; 's?A1,LE.JCJ TIMES HL'1?#I.n, '-'.73§Ll.EJ'U, Ci-LLIFDENIA EKTUEIIUEI Date ef re-fsrance communication: . adiotyjb-E 1D.u’1fEu‘_3} 3i._._. -.—..,1 fJ4_::'_€-_:- , ,,~2'.;" Specizrlatlsr —l-/_.-,’_. ._l.=.._ : I,__ ,_,F___ ._._f_ ff ELI 4'” um E- 4'-. Na ' . J ' «av mt E5-CITE: Teletype answer Result of gmmigcutjan: { 3 _ ‘ L,_ Examination by: S '2 "'u‘—"-‘-F’ ':--I- It " (fir Evidence meted in-: '2. _ I“. _ /_l.a-’ —~.l-1J‘It1'_ J-I Q.«1i~:C‘_‘.,—;..V- ,_z¢‘~._1_r—IK E) aid‘? ¢-Afi 19'!“ T55”: —-Lvt-~ |'_o-'{|.'-"';d"'T‘I"‘l-1"‘-l..L.,.‘_&F &1 »:...,.,“___mj"_.-!r,.4~ ‘H/~I:JLII.IJ-1-!«:'-’NL_@ fl.<._,,.4_,—uc?(p_r____ _ - “vk G e:°..;=u -"£"‘«.F—1.4'_,.- H-1~’—» _hI'.|I-\CE—1.:|_i‘-‘I-c7L¢.-u.’-..D— _ =-“-I"-'33’ "53e.s_-L_-:12;-.,....«.....r...»..\II‘ x:3,*~,--c.5 # __‘Cr'|:r.¢'|,_} _, ‘ I , " r‘£_;, Exumm , crrnsllet.-ed. éeihj Dictfltg-d ma -.-.d 5,,_.- T me D ts Dot‘; "*- .~-4 . '~ ============================================= ./texts/FBIZodiac2/43.txt ======= I ‘T: . ‘°1~‘“..:-.»‘~’.,7?___a{“. «amt? = *'“-G5’ ~..L r -l ‘t-_,7L{Fq-~ 151»: . rfic "‘ I a|'Ei'-” ============================================= ./texts/FBIZodiac2/44.txt ======= ?'.La'1fi.;».-. -I-LT-5.’-"I “FEET ._ " I I E .. ' I:-"J-‘V-*_ _-1¢6— 1-4B1}fl.J\'I'DH'!' (I: rznmu BUREAU or: nuvssnamun wnsumnran, 1:. II. 21:53: W: Ir. Jack E. 31111:: Oct-am: 2-1. 195:9 One! at P511-mar ‘$1119.59. -b’.‘.L'i.ua1-a1: Fifi J'it:un1.1an.*. KW-'=-=||o=.I‘=|||IUb 0| u =r!m.Irun I-heater mud zbnl fine» L:=la-o-:U>=1-:- l1|_I-G-fl wlI.= be unn-cl Ior cI|'fJI.=.|-1|. p-u:p=¢=-to -ml;-_. zrniolca 10 HM |qvIu||.w:I¢u-an -or ‘R as-ubav-gutent crlmimfl _=N.Id\7'Cbt1u:I. Au|‘r|a-rl=atia= curs.-n-at reg aremugd for the u=9.._-,r .21, Labarasmry rancid In -cvonrec-than 'W'iUI a u.-J_;u gruI=:7dlfid'. 3,3: . ' Jalxn E9-40* H-aver, Dim-=I,u1 - Han: ‘rim! _ 7°‘-'9' “'1 2-ifli -iii ”“"-E "°- 3-:99.11— L3. M5-N°;?.EfiEF n—a-391993922 M. E='="|4~‘-"|v=-= '-W”-=='=-=-=' hr-'= fidmwsuoa aura--«~c»o= Lutmr 3u{2;'a9 Eacuauunqlaga rcwoztod; xcufieflt Epcclmq.-_u;.: £.’J.'1aJ.__r::1zi -at E;-mi taxman 13:15. prmriaunix m.:::n1ttnd by FBI, sue.-ra-route, fiaiirnrnin. asadar dim at 33:61:39. inn-thus‘ dvncriiad u 191 Laws: Q-i flaw-10::-a mfitmnked =*s.m amaczma, CALI? Hi 31 am. 19:59." ‘ma:-in; land printed I.dctr-us “'5. I. HMIIHEE 31;: Iran, E2111 E-3'uE.IIElE H-tiflfii ‘ID lZflI'l'BeB" my hand print»: 1-utt¢r. W-ginning 1: the uaardnger at than 3 to-e-nan-arc ...-'-‘ . .4 ,.»_r..'-‘x c_ 3;-_£:s;, emu Iruncinen E94295} 535;,” ;¢§9,é52_:;.ez_',=,,.»..« I;"{‘;::‘31'1'(i§!£rg-Encranarnto (9-53) -, - "733 -3”! I . " -"I-mm I”-.1:-:*=.».=-. |'..-——‘:._ - . '~. F339 3- , T icantlnueact an aazi; pug»! Ema xi-r-_&;,i—:1_ 21$ : 1:: ts} ============================================= ./texts/FBIZodiac2/45.txt ======= 4 . ,.I‘,‘,",-gag’ nut is mm :1;-ifgr;_ j" '0 HI I. iltliflfi ‘I -v.~-:v~--a- .-C.;___:.__~ ..-' ’ an ttphu. In _ _ N __ . __t ' '3 haul " '- " ' if’ n':n'-aufi: . "' Q1 n-u:.=£'q§'$ pflltlui ' 14 mass: @151 5..- an thrfl‘-Wk uullllllulllll taunt! ---=-'*‘- . we r .- " ’ I nufiwifiulzt Hutu tin = u.m¢dhfi1n..-_-- _ ' ==*aré$— .. ::'u-nun. >"r'-Fe -- - ============================================= ./texts/FBIZodiac2/46.txt ======= ============================================= ./texts/FBIZodiac2/47.txt ======= E]-n.1:he _1a'eekan.d'_n.f- September. 2CI"-._- 2l,j._'.l'-3‘I55_3‘; ' 'at1:auck.er_1'.'.§_n_the, __la_‘l:_'I;I,';r} I-33. V ' " 11:‘:;g1:41fiw;iéi%s£ai51i:‘é=&1.=:3:d.'jgiJé§EE.:' ski ‘_g1§.‘_§re",' ":'a‘1'I'_hoi_1g!i - in. ¢1‘:ii:'L'c l‘é-T-E l'oI:ia.1 _ I _ I"!-,’|'§§1.5_iE:_5_J_1.-'!-i_}£. '9.ffi.i.;§_a =,Lb'1¢_-"Ea." “ 1_ "3 .-:1’:_'»; art; ============================================= ./texts/FBIZodiac2/48.txt ======= ============================================= ./texts/FBIZodiac2/49.txt ======= ..,_‘ !'”"""”“'FED£l5=nL aunuu or :Hv,L..=acAI|uri Wsaiinqtuzh D. C. €95-33‘-.W- REPORT of the 3 innnmcmou; nnnsiou. .£;f750£ ' LATE!-ET '-F1nc;_E_:1_:= F?1_fd'T'S"E\[_J-1'-#l'€ITE"' . 1' UR FEL ' .5 _ :- - -. ::r%:LE _2B gig; - ' . L-3§."l'2E<""l' GAS-E.N|:_I. _ £___-M;-,,fl]'_£ E 1-ms scsronr as mawismsn ============================================= ./texts/FBIZodiac2/50.txt ======= !.—G$ |Fl,,g-r. L'l-5--52” .-""-_ .__ FIE:_ r~._ f.-4_ '* FEDERAL BUREAU OF [I‘€\"ESTIE!.TFClN LATENT FWGEHPHINT SECTION WDHK SHEET‘ E9¢‘”d'5"55 lflfgffig 10:25 'a.n1. H-sierence Nu: 9'53 O . FE-[File No: M9911’-=’ HE'*'-"91'-'9d’- lflfgxé? __ _ -bls - L-<:I|:eJ1.!: Case No; EL-10065;-2 .5.n..s_u,-2:10: SAC. 39 cramento - - _ ' ' " ‘ Examination bgquggtg-d In-.-Add;-35539 . Cow tar.” _ - _ d\.‘._'_ ' - UNsu1_'ag ‘ . . (vA1,1.E;§u- I'I1~iES-HERALD-} VALLEJlJ_I';-__C.P.sL]F0RNIA — VICTIM 1-. ' 9‘ EX'IT1RTI‘1ON . -.5-flglgfi 53? reference zummunlcutlon: Airtel, 1U'.I'r5,J'59 -I ggj-::ehej11'i.'-§:'13: . Name I'll!‘ W Flesult of examinutiun; Exumiflqiign bu Evidence rsufed. by: CK ..'::l,I',.I5,_,,_,,._,__c,.'|:_, .:9—E.-;:.ffi1,,Z: {P19 . -.. J - .1"-?-wager", fsjfy;-Jjgfi .9 _:-: _ . /afi E3-"C[|'l'lil1E[liGfl campjgzed E .' .-«'rr‘#’4?"- /5‘,-_'.?'I'3-‘ fé 5' gjctatsfi -'5' {fa E : _ ‘Dc: Time Date .-11.9--13%.‘-.,-.—‘_ ._°..v.........._,.j,_,_,,._..:,., 4-»-n—r —————— -:—w w .._...-...-._._ .-.._ ============================================= ./texts/FBIZodiac2/51.txt ======= Fee-3.5 u=’.§~.'s.¢2.HJ -../'-L FBI Tmnsmit tiw following in EIIREOTGR, PEI {B-#9911} ATTEHTIGH: ?BI LABQRAIGRY ' .3 5 531 D2 n'1'1':1 _:_ '1-I:-.‘-.5.-:-.. sari}: 5.-.3 .r.Iu-.Nr::s¢-an _I:s:2_-25$) , _, flu ' ' '- "' .""-""“:c1__ ___'s-.__-1; .- uaancr: uirsua; Tb-= «==-me. - .' -E mLLz.rn tmms.uzmLI: - .~.v».g, . .1r.u.LE.Ia. CJLLIPGR.lII£L_- vxcrm _ H‘. ff_ Exmnnau . >-‘$5-,}~:C.._.?,E£.__ nu: Sacramento ‘:9 ;- ' 1, I W ._ _ Egfiumau latter to Sacrlnnartitc, 3-.r21.-ea and Sacramenta- gln Tztnnoiscu, 1U;I"'HfB§a - - _ -. _ .»— : . _ fi.¢'1aa;nd: £;~I'- ‘E11! -B13-I'1I.l:;. are . . I.11a"ansign:g,:1 lethari and -Inwartl-.-ape, which '-mveiape in addr¢aned_ to .'.a.r. ehrnninele ,1 -Sun '1"1"ID- fiIf_l._if. F1-use ‘J1-4sh_.‘I-u Efditqr“; . ' pnytplrkcd San ‘Francisco, Cfillfé-ré§.n,. 11!.’-13-u'E$a - - - . England for saeranadto ia em‘ hopy ed-eh pf ab-en--‘re-. deacrvihad letter and erivnlupa and out "campy -of San.P:~n.nc1saa-__ . malice Duparlmunt warm:-:1 fly:-If fit?-BL - ~ - - . . - ' - - tier; of "tn. .nuz~an'u and Ernnzbanaiiiaer, Inapaétuti‘-_ an 1'9anciu¢.e-Po1£:e._'Du-pnr‘I;ggnIit.'__adfij;gedr.-- our-2 13 —1'H_i'& that lhfivi -Idtaeribad lat-tn-r. "and 3fl'l':|§'*_a~. -' ' ._ .1-sauc_‘|.‘1gr¢,:I by, 1:19.: ."'5a.n -rmnaisao ch:-oni.+.-:1a'* 3. Sun -Francisco J1, $111: !!_6'II_a§!{:I-I1‘ and rfn ‘ " they ‘sun-;‘r " l3up'l:r"|:n3I1'It'. '- Innpeléto ' aura nhtainud fruwthn B _ cnopiua of an: an ha‘ 1-¢prod.u<1s'd._1:he3r. 1:1;i.s attic»: ‘saith I"l‘*&qttIIt -xhnt-.:th!lfc§lbI}a; lfltnnt and ui._ng1 _gcz‘p:_-int;.-_fl=1nn":§‘g;t‘.h Q: H" L .- -B an clu. Ii) -. 2 -- sun Francisco 1. ' Au%l'%€é£‘-“’*”L _ - - .'~ - $ ' ' _-Iva r ec;ql Agent 111 Charge . __..... .._..--v -..._._---- —u-- --..—..._m— _._ -_- ___,,j_.. .. ....-....M.-a.---u---«.— -—.—. _.. --..n_.-—..a-_....,.-_4.¢._.._-.-.—_ . - - .._.. .._. "'--.._.--' Le” ============================================= ./texts/FBIZodiac2/52.txt ======= er a§1§és - |'.‘..!.G:!J_°i" ' _ cu:~:~iiép.1t1§r"=’h_-1i._t:g-.'=I=_-in .- Pa:-1i::e;'De ' rtlirnts’. '3°?'*¢91‘9-1 huhllflmil ============================================= ./texts/FBIZodiac2/53.txt ======= ============================================= ./texts/FBIZodiac2/54.txt ======= , '-. -- Labqncngry 'r:pn%-rr-Ln-:I| Fwm _ ' L 7'"? . .. . . - - - .. -: - '- ' “E.-5 '_.....:am--- . _ _1.:I_.1_:“u_mIv|‘I:I:I._!_L'L' - EEI'.lll,_ Imnsnu eI="1I_fl'E$?I1_:g1mfl ' '-""‘.'-‘*5’-.'_"FT'5"" F" "H ' u1u:5T'&A§r:'iFE.-rAE:E' ============================================= ./texts/FBIZodiac2/55.txt ======= '-.T_-it: - .-i " Ilf HIE ‘.7 : _ ' ' .-‘._ . fi'I\ _ . I ..,..,—l;£,.g_ LLEDRATDHY ..-_H:- _ Fgnslm. |ZIF_: ni§*EsTbnnnnu' . -‘T "A'I51-ll_lII'iI:I_Jf_I_l§=_l1I,'_¢. 'j'~:§_s:5'~~_- .1»: ._m. an-rxmam 452$? ' '='.K.--‘-.- } . (_§['F‘IJ_- Bro. ‘gem? '»- .=3-7'§g;,_»—»—~—~ 1:45:15:-11:: (5) 2%.“ fgg/,{_ ‘TI-uU.nc T80. Euca- __,_.£-|u-3¢::- " =3” F1-nu-Jr '~-...-._- .. ......._...,,_.-_:. _::. __.. .. yJ.II_, ngbu U Ta'_ETTF'5 ':lfl'I1'[:| ============================================= ./texts/FBIZodiac2/56.txt ======= ============================================= ./texts/FBIZodiac2/57.txt ======= ============================================= ./texts/FBIZodiac2/58.txt ======= ============================================= ./texts/FBIZodiac2/59.txt ======= ============================================= ./texts/FBIZodiac2/60.txt ======= ============================================= ./texts/FBIZodiac2/61.txt ======= ============================================= ./texts/FBIZodiac2/62.txt ======= ' FEIFEIAL Human or '*"'*“5H|NGTDI:l*.nII:r:E.5o!_ _.,.w MO r... I D E N. L. BUREAU OF IHVEETM WASHINGTON, D._ C. :1.- .u .9 \zn.._.uz_:n<.3_ .U ..n k=_..=u_z_.._u4...__. zO_.._.4M:._.mw>.:_. no _..¢m..:n Jduuau. ZG__._..fiU__._.m.u_3_2_ 3 33:3: .:_£unu_. muzmn.....u uoz,u...___>u .. .u ...... .:......E_:=._n.n:a n..E_z=_3_.? . .1 :_E.._.5 ;.u..:.3.2_ zn.F...a:¥,....1a _.:... .$q§._.._.a ...£......Is ,.......J.._.1... 9.... L. ============================================= ./texts/FBIZodiac2/63.txt ======= urea-2:0 (12%-P6} -' ; JDDDQQE FEDERAL BUREAU OF ]If*l‘r".ES'l'Il.7..A»'I'1|.‘.|'?."{ F'D]IP.§ DELETHO HLGE J1‘-IFDRPIIATIUN SHEET _,;Lw_ IE‘ago{.s]I I-iU:I.bc>}d ea1.:in:13r at 111.15 lucefljuu in 15:: file. One -:n' more 01' the fnllewblgstatnuncuts, wt-,u:1,-2 :i_11::]_'i|1a'I;ae1, cxplsiu this I:1I:Jcti-011. fl De1et'w:1s were made eersuaut I0 ma emnptiom iu:-i?mWlla.ti<>-11 with She 4JL'tu:I sgnufii-as]. Peg-2(5) N:-"LL]1J1-eld jnasmuch as 1 final release detangajnatlon has not been made. You -,-.-i]i be; 9dvi,aul:I .3.-, 1;: an dispoasitiun at a hear data. Pages ='I:re not considered. full: release :5 way are fluplicamre of Page-Es} w'Lfl1J1s|.d for the E<:-|1vaw1'|1§ ma.io:1-{s}: N The following numbed is to be L15-‘B-I1 for zeiermee :eg m pages: I -r .5 £3» : E- Egqf mi”; XKKXXJEKXKHXXXKXE 3C DClfied"P:Ige(s_”:I X X No D‘IJp|.:'K::x:iu_=_| Fe: .3: X for |.'b§3 pug-t X XKKXKECXXKXXXXKX }C3'fl(}=€X}{ XKXXJEJE XKKKXX . seem: ============================================= ./texts/FBIZodiac2/64.txt ======= ============================================= ./texts/FBIZodiac2/65.txt ======= ============================================= ./texts/FBIZodiac2/66.txt ======= ============================================= ./texts/FBIZodiac2/67.txt ======= rt.-"=+<=;“==1ri'=rrti_vrF2rs'_ci5' rum: n1mc1}::n,'_rBI _(9-49911} , nizronnons 5 - '_ ‘:.,.'5=-_«-:_-I-.:_‘._..._ _ . _ $1333“ - _ LC" #1416042 |L- H 'l'ELE'l"u'PE lf.‘~ll."1' "'.l : _ ============================================= ./texts/FBIZodiac2/68.txt ======= no _, . _. ., _.:; -.,_{_-_-...'__j_!c.a- ..- . «.- ' . --:5, FHA HI} 9- 23 36}! .,..=..1_;,'7.'..+gx:~ Jlstfigtunrxn -43:. 531535 g-azzusqrm. -» -. _ fin '_":hi‘1:.|i'1'T1""I-|EE§':5"ifI'_'E_SEt12{: 513- . -. :-~- --. -- ':-_=' _ in __ N... 25-". _- IN 1nEaz1'1F1r;a.11uu___:rILE . , _ :1 H ---' ‘ "fix ‘J-.~=..-3.‘ _ 3: '1-5' 7, gunman SM‘ 1-'1al'.n, c‘t__§c_2_z«' Qgfi 1-gp '=' . __ ,.. . -,5».-.. 3:. mm: .u_un;n'.e{g«zu::E1=.n -.5; ============================================= ./texts/FBIZodiac2/69.txt ======= 10-—23e—E9 \ p1.A§?~ £1‘ w;~:»‘- TE'I.-FT':'t1:= - I5 — 3fi"x—' -1“ cfif ‘)7’ 5* 5? N ‘” T''1: 3.:-L, T._=1:-' F§‘.."s?.'CF‘SCE’= {S—229fi) 1'-"?.f'.!.1{: T??.:"-.,‘?'E_"FE‘.|I~‘., E"-3T_ .» IWSUB: ’"s’.=".LL‘-“JCI 'TT3!|I‘S—1'{F-‘.3_r-'1L]I}"_. w.;,L.1?Jr_=-, n::n.L:3r_>nr:I.¢.-. - ‘JICTT?-I, FK’l”0RTIf}1'T. T{5‘[L’-?'J."‘°F'L "QCT- T'.5J'}‘I1\".'-."E'SICI'3‘NI3 LAST. HFKSES {1\IFGfII;§J.e'xTIG'.‘*s' FURIEESJEEU U:‘fJ'-'LBL]'-C iJ.'JCJ1’1"E. WHY I-'5'C'.}E\'5?I =mT- ms W ?i'RF,5@:_»_— I13} -'*--u_...... .- ' fix ============================================= ./texts/FBIZodiac2/70.txt ======= 1;?“ ' gm ". .-_.£-’t= ; := 3 5 ' K, -54: L .3" _, : J; - . T:xInzmitt'r1ef<::lE¢~:r¢Lrsu; in _ _ _ _ _ ' _..’ ;uen:;ty Mm .s£r..EJ:.:.m£;~i?é: n.E.m'r:.:'t$ an U«E_"_'_ *'=¢'.r1ie§ 91.‘ _ _.~_ _: V" Aqua in Charge 5 h”¢¥ 9 1 :,-E ============================================= ./texts/FBIZodiac2/71.txt ======= '» - _—_a Eum-.1 5 ':“-.a<.:i E ============================================= ./texts/FBIZodiac2/72.txt ======= -.'C-C1 [F|='\'. 5-21-d~1: Date: Transmit the following in E I I I I F E I : i I I I -"T31: I"-':| yEu='-‘H-19¢! 9-’ -:odo’J I I I I {P.rI'a.—.'J_;r} I ‘-7 in - ........... ____ -L‘ . . .1‘ .::x.:. I-I.'I' L‘? » Fe San ?ra::iscc ai?teL ‘I~r:‘-_:'='.e:_‘- Far Eh .- !‘..":_t-5:-'_“¢‘{'“.:'-:*_; 0‘? .5 letter 3."F£"_:§ "‘“-is .'.'ét‘:=.1r 5;: _ma nfF_c2 33 the San letter Terq .86. P.i,’."7IE_ . .RE£-5_s:§r‘_“»7,»9?,5; E If? --.-._....._ -—:-—.. ._--u.-or Burfinu f7":5. 3) " :' " 55 ?s7"etattc {E-*9) C Fan Trawcitzw -fipymwea; sent H PEI ‘ ‘= ' 5|:IEI=i.U:l Agent in Charge ============================================= ./texts/FBIZodiac2/73.txt ======= 1 |'}|-27- I559 PLAI ‘h_;.X’I' T}? LE TYPE ' EIRGI NT we sin: 5,-in FRANCISCO {:3-3395} Emu I:-1rcEc'r'c;sH ‘FBI (5-49911:: _ uHsu:~.s;"‘in=.1.msao Tunis man HERALD, VALLEJO, CALIFORNIA ms}: vrctmi, nxmmzdn. I nmunrm. 0010331: TWEETYSEVEH sxxrmrmz. LATENT PING-EEPRIN’_I'E PREVIOUSLY REPORTED THIE C553 EDT /.h_ -“F-Dfimmb FI1*"=-m=BIN'Pfi— 1*“ N"mR— " — ”R— F31 "”m“— U V — no i1=5.LlI PRINT-S HEPCE FOR TH_E53E INDIVIDUALS. '1 1&7 DOHTI RI-II NC: . LNW:1ws’T~§? £5} * . 2f .1‘ :< ,, -. -. . Hnc|,\'_=3<:»ou I:!_r.n_=u:£r\-95 Lam" .; ============================================= ./texts/FBIZodiac2/74.txt ======= - gag.-3 5.1:? T5: .-_s=:::--.l : . -.-.-. a._ . f . 4.3 - —-L‘ Ll-B D11.-Vt‘! UH-T -- 3.. FEIJEIIIL-3EiHE11.l.‘F IJF IHVESTIGATIDH '1'4|'.l“..i«l'Il|_l|3TI?.I|i, D. C. 20535 Tm: FBI, San Francisco (9—2236}' ' " Ti“ October 24; 1959 «El-I4...-_.m..,..u. _1-=3-.§ adggr 2-sq:-mr. '2-lr€—.3::= Unsub; ' ‘ Falleju Timfis - Harald Fallejn. Calif. - Victim; Extortion CF}: Sacramento _ ruLF:I.:~7QE:f:_'-- ghflggll .;“F““““%e«=w9&éH= San Franaisco LR'Em - Egiflpflflés LL " "===%-me-== £.i.ri:Ia1 dated 1::-,*21xa9 E-:o:o:i.na-I3-an -cc-cI|.I¢5'.I:"£|: fifififififi fipecimanfi received 1DfB2f69 Photographs of Qelfi and Qc2D, previously submitted by San Francisco under data of 1o,r’1'r,*3a. RBEAL-l1'k£: ' You were pravibusly advised of the examination _ QGLQ and QCED by Laboratory report dated IDKE4/E9. The utag-raphs flescribad above do not alter the cuufilfifiionfi t iarth in that rfipflft. nI.-I.ILEI::- H, iU'GT 13 4: E63 A representative copy of the quastioned letters ceivad in this matter has previously been added! to the hnonymuus Lqttar File. «:25: Tha submitted photographs are x3tainfid- flu Laboratory report is attached; _ l::::2 — Sacramento {B-63} £EEE;£fif::, _- .' :”%> Ffi} ‘lIl“u|II' '£E]3!h1[17Q:i'*='c'3*J%:-=1§33"i"3==_ar?v=-afaa-=_|EDr4IM|5Tfi,aT5-..-E Pfi.-GE ‘. ============================================= ./texts/FBIZodiac2/75.txt ======= _-Jr_§E{E:.'J _ = Ti ,T3;~*5:“5*§3’=3"3"'.V.' '3: '-is‘-“§;f$5'E"TF-_. ' ‘nu-ni-_‘n'-?i?na'1: E . «.5 ============================================= ./texts/FBIZodiac2/76.txt ======= 1 ."g\_ 531;; _i,'N.E'i‘. '!.'1—a‘-'53} I «-2~Bl'-2'4 FEZDE HAL Bnfiahu 'n::1="11¢'-}'Es'1'1-:;"Je».T1c:«'M'".,. I LATENT FINGEHPHDIT aEc:'r1nm 1.-rum: 5Hz:Ej;"-' _-__ ' " ' Heccnded: 1'0-37-I39, 3:10 3. III. - " figjgmfigg Ng;'9-2295 J f .7 l-"B1F‘11e'Na: _9--19911 ' Fiefllrivedi 10-E-39, jag _ _ ' ' ' " -' L.:m-i'1t' Cane Nn‘.A'-‘IUCIIIE . . _.;, - - f.:-_. .-.g-, .-_\._-_.:\\5<_:-L-5:. .' "- An.-.=.wer.tc:.:- SAC, San Francisco Exnlslincrtinn Iequea ted by: Addresseé G99? to; BE: UNSUB; I ' VALLEJO TIME;-3 - HERALD VALLEJO, CAI.-IFCIRNIA - VICTEHI; EXTDHTION Date rsi refiereénce carnruuuiccnic-n: Teletype, October 24, 1959 Specimens: I 55,;/Lgé/I‘- W’ I‘ _ Egg: Telephone answer if idnnt Teletype answer if n~‘.m.id£rnt esu-1I: of examinut nn: _ mmim an ' - !% /__,_ Evidenteumlzgw ' fitffi-nqi=P.£¢«J£7§?»iJf9)+ac: .Q.E.:f'*fi«..‘;+r.£g.#~ J-’Vv--QIJ1.» I ‘U I . loqb »9fl‘d§' In1L,lfiq;; 'aL4-J;-“q. lglh n «=;n*=a« I, *\»rv«a=fi@=-e{‘2«T””’&!"" - . L . ~ '49 I Examination Wmn1eEéd AIQELL Dicautd' Date .,... ,_ _ -..--:--1: -x ============================================= ./texts/FBIZodiac2/77.txt ======= ‘r'.':3I1‘mg!:>r<, E. C. 2353? REPGRT of th% IDENTIFICATION DIVISIIIII LJ1'.TENT'F||"Il3ERF’R||‘n|T SEfiT|ElI'I m U:fi cm; 950. 79! FILE NO. I |.._-*-"'-'EN"|.' C-flu-E5 ?'-'D. ;L_ _ =3Ic‘.:1:r!:-e-r 29, 1%? TO: ME, San Francisco "E_"__ s.13~.1:J\Im»'.-1': SUBJECT; 7 VALLEJO megs HERALD ‘i.?‘.—‘aLL;TJ{2I, CALIFGRNIA Ei=£TDR’1E‘ID}'€ Tale-pémne call fmrz: 3.1:: I-‘rm-::§~_:«:o “E=='*"'-'== Division, on 113-21-fi E 3'! F~-1cl.||-|l-'|.'|.'CI N REQUESTED BT: EPECIMENB This rapart supplements and eunfirma mfiornsatinn teiepu'1::In1ca11_'r furnished 3.41-an 113.2 1.39. Latent I'i:ngarjprI.nI'.3 pr ' “ aption-2:.’ ‘b"i"3-* - case and case anizifled "T.-'n,suh. ; Cecelia ;LE'.i'E _3éLepa:d - Vi-cti-.;.-5, .='_.;;iJ: E“, -3.33; mag, __.,ap3, Ce:-1,mtg,.r, Calkmrnin. September 21, 1959; Assam Er-lureiar, latent case #A—l23 ideutiaai In-ggexgrinta an F El La.I:Er1t impression in an-t case iF.:’ri.23W manpared aVai.J.ab1e fingerprints a but no 5&2:-iflicaticn eifected. major case prints cl! ‘ch are needed Eur comparison with the latent impression aunt previ+:rus1'_r.r repflfied latent palm prints. are not contamad Idenfliieauun E:'iv_i,.s.1J:m Eil.-ea. 95:31: /c,~;.;z--9~=}»,x,x.e.:i°2'53‘ ' ,- .n' L.» 5 5- ;, TH-'3 R£='-F'I5‘&‘.g‘ -'5 re.-Fawsn.-;1.I FUR -:r.rm:.r.u. .'.rs.=: agar rial; new ':'Z|_ 1-‘-EL:-T*n‘.*=: -_m:_- I: 33:1 Francisco ** .i_ -r: a‘ E , ; ,._ .' JCS: mlgl - '- - _ I. " I41‘ I J':n?l-": E-3-J-aturor. ULrccw= : '‘*r-~—. ; _ __ 5, ___ ============================================= ./texts/FBIZodiac2/78.txt ======= -..=-~,-=1,‘ - l-IE -tFln1r'. IL-:6-6:3] I-1 ' -is 7' . « - - , 1.';3j">*‘ 1.-:3? _-," . ....,;_ FEDERAL édamu or IWJESTIGATIDN ' ' LATENT PIHGERF-MN-‘1' SECTION wont-C SHEET ' Fleo:::;1d,gd;1C'-22'-'59 8:00 a..m. -Hflmm M093, T ' ' . ' ran-'1e1~: =""l"¢r¥ HE‘-'EiWi=1‘3'33‘59 £9“-‘* ' - - 'I..~IiweI1t1-Cass: It-LDC-!L‘2 .. ..... .-=._=... ._,_,_ ,_ _s?_€.‘ .._., . -- .- 5:». -. -v x._-- _..,» .- . -_._ ._-V. Answer tc>§.S:°.C_. San Francisco Exnmiumfiou Ieuuesled by: add;-95539 Cop-rho: RE: Lrnmvmww 3r.1:a.1E cw; - ' . " '_ " , VALLEJD TIMES HEAP-LI? ' ' . ' we.LLE.I<:+, c:.u.LIFoR2ma. H§DI'oR'II<:}H ' U10 Dfltte uf referemcne rammunlcation: T9'1513hGI1i? Call i'I'|:H11 3* San Frandiaco 31=Iscimen5:_ 9'1 1':"21‘59- 5 wilt’ .. O - V! W may - - ' ' «cf F“ i 35”” SVIEPECE with pad in captioned ass and lat.-ants: devel tj_t]_ - ' _ ‘5.’IG‘I'Z[E§. LAKE BERHYES ’ , |:,‘fiLIF0'RIq']'_p,’ ‘Fm ,, 5EPTEN3ER 27; 1969, Assmsaw, I-[[JBJIJER._,B1Lf§.le § - -,Lc:#p.-1239? _ NED Case #lOS9D".a’._. 3. _ [M P) 3, _ _ _ .. . - Ha-aull: Bf examination: ' _ E3{|'.‘I:|'|'Lil‘|.rfl-EiI'.I|2l_ | . Evidence noted , I. _ _ @fia+1JXAG§(4_;Jffi?Aa§«}%'f{ “‘&*"'7*"'§é:°*"=‘*fxa-«vr’):/»m~ ~,-~Z1/L ;I.-;:}'i:'= WW 7’ g .»»..../f.» m ,mq",£;*,~;,:7;.«&y_:\:;\a_* - ' :.’l-<2-uz-:v"_ ' ' _ . . ‘I. in Exam-inuiinn Oclmplgt-ed E if L? =?'-7" Dlctqlad J J ' I ’ TEJTLE ficlte 3 7 Dam. It i ....n.__ ., ____ _.. .. ============================================= ./texts/FBIZodiac2/79.txt ======= ?C- JE —~. .':-3-2-545 _#._:E )1 X“ I J J r F El : Du‘.-E: 3- ". -I ‘- J r Tn: nsmil the following in I I’i".~'.P-= <'= ylontss-t or may ”—I I ‘M-"1<:_._ ' ' . '- ' ~r_-_.-.-. ] .-‘.9.-ml-[:1-J l 1—-.————..._'.E__ ::T.1=n.-f;,- » ..~, . _,: 3?('.'''.‘F'‘,’? 3:53 '37’-2|.-’2‘."‘a.‘;:':;=3n‘.:-'3 I1 .4 fi. rngaa {E1 _ -;§tPT,A_a; 52;? H a_:.-: one (11 cup... $3? fill 1,fi_a,__:.F,-_S<__c 2::-,1-géfi; _Q__ar_%___‘__, ‘M r -1-"-W-I -=9?‘--=1?‘t!?*-9’1tal -2'!'.O'£'ar!rIa dated L::;1+:I;=1:=; ~}~i,~;.l' 5-"°31-at-=.fi fr: me e1".I:1,:::=.-gr! r-.—.,=..n.—..:fl..- C. - .-_.,, ,-' ’ '_' <- -:.;4‘"_i_-’I"}h+r-;n~. ' ' ' ' " " "" """'° '3‘?! " ""->= -5 5'91" _._._.v.,, ' ' .. . ' 1-5-E‘-T8": ’ ' ' -':'i‘:' .“::*..?_*§,g » éahfiratnrv is “flfiggg iii latent: ifi 835:: ?*:g'~-_--eeA-=-e-1 --. ‘* :9 °;. --- ."? "~ J'Ll;s‘.LiJ Li‘! i.J'E"§~ '.s M M ..;> fl?-+7-3} E2."-'9} .-~..-5 Miflfiiflibt ============================================= ./texts/FBIZodiac2/80.txt ======= r s“¥Q5}{j 'IJs'—‘uL.L,E.1|] Pull... "l‘J£F'F'u ED; SHERIFF 5'3LE|l‘l.11 ‘EIZI. EHEHI IC.I.Io_ _ F.EI.’£. -45- N '§'a_p.:i;.~';:sL:L—, _" 5 .'I' I "-.' I " ,F:O!.f.B§:_£-:1 D[EP_ART§flnn\-;.:‘ 2:" I _‘_. m:=;,T. nun. nay. -Mg-'—.: " ".r_- . _'.L_ AL]. of the latant: prints.‘ 1-!‘l%'I!lL::I'.‘ '__'ease-‘usére uhtainad f'ru:n_'a taxi cab. Thél latent 1::-in't_a’:t.haii"«an'nn: ti:-a.-:35 'u+‘ _t:1nm:I _ar-B ,3-' ‘xi; .-‘_-__3_& baliéusd tn Ina pi-ints n'F"j:ha su_é:1;ib.i:§_t~. -~.'.' “:' i_. . , gs;-’a‘*‘::aa=.a'at-»g='fin»;'a ‘mm ., :- _-. .— =.¢.- .- ._ __ .-. right IF:-ant |'.‘1UUI’_l_'_!_fi._I1I:l_:|._E_'_§I£:EIlSfl balieuad tn lg‘: prints uf th . ;'-_ssa_—,“”‘_—<-:2.» *-" . _=.r"".I_‘ j.-1:: Euspect. These prints at-a circlad uuth a” ad hen. L-1%’ !'i'I.a nther latent §J_:'.'i1'|1:§:--I-FI1-£1-!;|:';‘ uf |..:1fi:i.:'h_'_are _;J'Bi‘|,r gun}; pfifits. -" Q" r-. -.-" 3' *.--+3 -,-. :-_=.' -- '-. ' -:. _, may nr may nu‘: he prints _nf ___~'-.:I;n_a_5-1.|5|;u:9:I::‘r.__g.r_I-:'_"*i:'.r:uj.s:.s E-552;" , '5’ time 1_a|:r',"f *"'*f =9?§**é?¥-'.i'*5'§:$$. 5 'v=-' Q-TAR ' ============================================= ./texts/FBIZodiac2/81.txt ======= . ' — =.':~m Fifi-ZUEETEE 33$ 19::-:11;-r :3 92-:?scz33, '[_j;_q::j;::;EI~'2’i.'..L“:’ #E_un1f3 Q? '\. B-pt. ‘L510 ============================================= ./texts/FBIZodiac2/82.txt ======= “'5 :'1‘eFfF!EE .5 U¥K¥G¥¥, '-=: Haau35?”jAcK3aN- ============================================= ./texts/FBIZodiac2/83.txt ======= 'RKE:ad5 (10) octusaer 24, 1.2159 Airtel 19'?“ TD snca, San Francisco _ L05 Huggins 3_.- - Jnc1$§<\s1?i11e - ' .r '-. J‘ ''''°‘ ' 6/a_, .—o-rs? 2' K __..9;*£1_=5T:::tgfi; eras-9) , *r’??H H. . .;_ .1 5-r-' 5; . [*- m1an:niraato:'3}51z_‘§1 _ _« ZGEIAC KILLER, EAN FRANCISCO, CELIFDRNIA HISGELLAHEDUS — IEPDRHATIDE GGNUERNING Be Atinuta tel dated 1D/ESXEB. This will confirm telephonic instructions furnished 3an'Fran¢inua Division this date. In the absence or any Bream violation, no investigation shunld he conducted in this matter. San Francisco and Lea flngelea insure information contained in rnferencad teletyge furnished to apprqariate lucnl authorities. ' 7,:-.~a SEE N0?E PAGE TWO E. '-.r'§-fit? ._t ‘id; I’ . ., r._ inn. noiiufi-"El-§'U.i*rrb£ :Jw1'|:| J ============================================= ./texts/FBIZodiac2/84.txt ======= . git.» bx}? . NOTE." Our fitlaum Office was advssed 1I’.‘r«"23.’E9 by a 1:-cane -- tn identified" elf as_-that t e *,»'I:IiI:e 9% appearec; to be identical tn the voice e_ e ediae killer who is 'ur eutly being Suught by California authorities. -indicated that’ His eurraztly lucat .1.l1 e Les éngeles Divie.1o:1- e 3 ated that she had heard the voice of the zodiac: Esiller on a television news program at chick time the killer was talking to the shsreter atterney Me-Evin-BEIIE of San Francisco. We telephenicallj; r:rJti£.ted'San Francisco to conduct no investigation in the absence of any Bureau violation. San Francisco stated tEu3_1.r would else advise I.-oe Jlngeles. ============================================= ./texts/FBIZodiac2/85.txt ======= .I£-.:—'-J .. .' F3: rm: Na. rEn_‘.*~*1 BU_E{E_AU_ 3 {If 'R£1jn;)nI IDENTIFICATION DWISIOH LJJEI-l’|: FJNGEHPHHFT SECTIGH flI§_i'h’;°‘3"'| GATIGH Efiyfifi ‘:"UUF-I r!1,,,: No. 5r.zfif_!5 9-43".-311 .~ rs-Iflifuifi 3&6, fian 3ranc1sco~, _C:<:tci‘.a9:r 29, 1959 LATENT us: turn. "_'CI: :-13: 3315353 , j i":9!'.".'!_£.K- TEE-IIELIEJ-'\T_Z_’.‘ ‘3':’|?'.'L,3.]'§.7 . =3.§’aT.L5"'._‘EN{fi. - VICTTI‘? E.'I'CR'!"El'.»'i‘I Ecrasawca: .airt.a1 2.D;"2,1f6'3‘ *6xAMtHh'I'5r.‘u:r Hzovssrsn at’: 5551 Ffaneigqg SFECJNENSE Pilntugtaphg I'hi.r1'.}' Latent fingerprints, thrag latent palm prints, and mm latent Lnxprgaainsun {fingerprint from lower joint area of a fingar ax palm print} nf value appear irt Sutuaiitted photographs. fine latent fingurprint Ldentifind as fingerprint of victim Flul Tee fitina. '.>'an Francisco, California, -.'.::nr1:»n2r'e= M9?-E-. item"-aiding latant fingua:-.= tats mat idzfitical finger;-rintgi of $ti11e 5- 33? Latzesrlt iazpteaaion compatasi available Etngerprincs 55 thnse individuals, but nu idantificaticn Elgffi-Gtedu ‘Impressicns E.-5 labrar Joint areas of the f£:I;;;q§5. and palm prints of these individual: nut contained Ehrcntinuefi as: next page} _ _"._JC5 I If ' -. .:.q};55:| ?ub—'vr wj :'.I'-*4! .-=5»: j j _ _ THIS REPEPRT :5 FL-'..'i!—_’b'f.5I.|'.§£| Eon oP;.r-:::.4.L L135 |::I.>«r.L1r' ~'==-°-‘= NHL F60-OH '1‘ '|"5L»5T‘fF‘E |.F«.'H'T‘I:| ============================================= ./texts/FBIZodiac2/86.txt ======= EJT, Ssn Franciscfi teacher 29, 2959 Identification :;i.1.-151-on files. Eatent ELngerprinta_prev1@us1"reported this case HE, nut identical Etngerprinrs :3‘ iaarches ware conducted in sfiugle fingerprint file, but ao'1fientIf1cat£nns effattad. ' pg of San Francisca znaamcrancfma, which W115 815;‘: suhmitted, Page 2 EC J3-10042 ============================================= ./texts/FBIZodiac2/87.txt ======= 5.: EDEHAL auazau or xnvssrzémvaow Lr'*-‘.'?_'V'I' F'='.'\"«]EFI1-"?!.[?‘J'T SE-STEQN '-‘EC-‘FEE’: E.’-EEET H'=“=Wii.F=1= 101-r23.'r59 '9 1 35 E1 .131. E15-f-are-m':.e N09 — 2296 ' FEE Fiie i1h:I: 9-49911 " ._ 9-‘?‘==‘?i\"-‘<1i:|.U.u"'2:3-.fl'5‘3' bla Latent C539 §\1'c~.',fl...]_|:;I|_'jJ;,2 .‘\‘r5.E=.-we: 1;: SEC. San ?rancisco E5(C|-'U.f|".¢I.iCIf| f9£‘.l£*S!=3>fi by: gddrassgg ,- . . ”Gp?{a' $AC, Sacramento (9-SE} HE: ' ' <*.-~'-‘-'* UITSUB: V.<‘.1.E.E'..ID Tlt-ES— 5-EEEUALD VAIJEJG, C.r’:.I-.IFGR|'.II.—'. — VICTIM _ EXTDHTIUN 0:’ refecenc-9 £uI7‘.rI:.uei:¢|_:i-cm: ,'q_j_]_-tE]_‘ lgfglffig Specimens: - .- 3 photographs bearing latent impressions Name ' =~ * W’ J '!. ' u ="nLsc- Sub-:::ir.I.‘.ed: 1:213;-.—::-a:3.a12m3:~:Tr,r. am:-9:: * . 194 R-zsuli of e=<<:Izni41a;i¢n: E:|:|'.'v_1[nq|[[Qn by I E'?id-3-awe: noted J . ; ..-— ‘P!’ 2", 3' 2' . : cf. ' ’ ," .5 -v' 5 as 9 _a , . If ff‘ - 5 J‘. EetéI:a!i:!<.'.2=.or'. c:nz:g';5:e-j g - 5-_' ./ .- .. -/ gmmtgd .- :- '.'_".| ol W '_:==_v :i’JE=a ============================================= ./texts/FBIZodiac2/88.txt ======= lifsagiizs 2 .~'\'.:_.ili'|.'gng;E: __ ._ _ __ .‘r\%'-3‘?-'oE.'*j.::5v_\-c:'.'¢r?.:,_-I4—‘__1'-lg-._Ji§;:_:x—. -_ 21933] -: - u... I H 8“ ' -\ . _.\/1 =_!!u1-!lI=o,u 13,45,911: ,__. ============================================= ./texts/FBIZodiac3/1.txt ======= Freedcém of Information and Privacy Acts Subject: Z Q1313 C KILLER file .E"r'.mm‘.r|ar.‘ 9-fig _1:_{,1'2fl§ _ SECTION 1 ============================================= ./texts/FBIZodiac3/2.txt ======= ;*::°.=:'$:::- '° F1 "'*"' —-= =u_=gq_ uu_u:.:r ‘Ta-1=na UN1TE.D $TA’J."E$ u-:=*}"r:P,NMEN“T ‘”'°'*”"* "— '_lC|'ILI°"$ 1-H.1.-.C.D.De'Lna.<1h “:**.,_' Memnrandu _ _ 1 - Mr. ‘H. c. mum ' - 1 - Hr. I. W. Cunrad f'=Dg;°*' 5 '11: ,-I-1|:-. ‘W. C. Sulliv 4 DATE: October 23, 196 an: 51 FT - 1 - 311-; J’. H. Gas. 4.....“‘"‘‘‘ T :__M___ _ EFJJM : D. J. Eramman, .J'::‘;.;,-( 1 _ Mr‘ A. Rose“ 5 ;:;l:Hn...u._ '-‘_° ' 1-Kr. G. E. Dmming '-""‘*’ sLra_]Em'; .IJ!EEHCFSJ'1*-T SUBJECT‘ (Ila: lander 1 ' 1131595 maesJ , califarnia 1 7 {IQ ‘filial Times HEKHH A 'H.[ai'La"a_; flrzm-EL bi. ' elephnned liaison 10-21-59 and made reference to a series of mxrders tzmsmifted War rgcent weeka by an assailant who has T.-men labeled | by the “Press as the ndiac Ei.‘.Ller.*' He fnsrther ‘IELEl'ltiDl'led that following such" murders, anagrams have be-an st to the Press, it is ass-umeri by the -|.mik::1awn subject. Recently, the "San _Fraa1-aiscu Gtlranicl-E" pulish-ad EEK I.1IlSD1VE'd 1-‘-D1-‘ti-01-'1 0f .= .=:_; 3121 described - as the last line of ___u 5} . .. lained that frm the newapaper article it would appear that the reznainder of the amagt-am had been solved. ‘bl ‘H Ihe above infclnnati-on was teleptwnieally furnished our San Francisco Office at 1:30 p.131... 1fl~2l-59. Enlpervisor ‘(ab a,d’l.i":T.Eed that he Huulii 133.53 Hjis 11:,‘:fOr‘l31a._tiO1'l on to the-San Francisco Efolice Depart 1: and the Liapa Cmmty Sheriff's Office without disc1osi s the source of this infoxmatiun. ~51" .. A91‘? Ft! #5’? /A’; ‘L,-,.'. EEC 4,: ,¢ ~ "-3 .;:‘:f"‘E‘4-at infuz-nation; . , my-e 4 1959 AC1.‘ ICIR : _ ‘- EN. _,r.\ _ ¥{‘3\fi}JrE§1§15:] 3959"”"E:Lp.ss:n=:EE:u air":-' F54 ' I - ---,-5; :25 lfiSS!FYE2IN:25;( ,5 ' e -H’ 13; =:‘s«=_‘&‘-W" ___. a"”‘—’9’°"'?~/{-1'7?ra1;”~‘<:3}f‘E’:7:1‘-'-" _ ‘a ============================================= ./texts/FBIZodiac3/3.txt ======= 3T..AIE’I'1-7.!-IT 11-1-59 _ Tmmpn uncaaarr rm: sac, sax mmeczscu (9-2295} I Fawn; nnracrcm, a-§__:% {$499111 umznowri S @mm Tums 3 $1151.13, va.L1.E*1.f&_, :::n1.Ir— .-’ uaxizza - vmrxu, EITORTIOH. FM, RELTHTEL OCTOBER THIETYDFE 3111?.»-r:1m. LETENT TINGERPEINTS A211} I?|{,?'.'3.?1$5IUI1'5 PEEEVIGUSLY REPORTED C.‘-._E-‘TI-DN- ‘E33 easy NEH‘ mnzemcu. FINGERPRIHTE UF—EORN— — IN :21‘. PAUL, nilzmssuwkfi 1'31 1-fiJrsaBER—I —°‘*— m"_ b’]{-'' —I_N BRADY, TEXAE, ‘EHO my BB INDIVIDUALS 1ma3n._ 3-_£g;H,UJ ’’‘”’‘''’E 5? mg‘? ”'’‘‘'‘‘”‘‘“*L5 1*“ mm — —'Wf ‘=°""*‘I““‘-‘DE"T- Irxca-may‘ RECORD. CDI€|'.?_iRi[IJ\TG.- I M3?‘ .195 :jp?’i";7r '2 E5} _ b..,,_,. _ . . "'3 . I I Qiggfg/X1? '2' 3'-2-"r" f'.« ..'- ============================================= ./texts/FBIZodiac3/4.txt ======= "\f'\F 1o~31¢s3 pmrumxr RADIDGRAI - URGENT Jam. 'EauatL EAJHDCIL 5 5321113? or HAPA mmrrr : , ,_,,_.- "r,.;.: ,,»( - L H-I: nrrzcrxvm a:.umGEmr1- -,5- .. - .-'-'‘:!.n/ '= Assanné -» MURDER. nxnncnsz Iassuv. nmumunm 10-3143-a. L-vrmwf rm-;—sapr:IN*rs man: Largnrr rrmpmamans arms max new IDENTICAL gr“ FINGFPFRIRTS °"E—« E==R*—N° PM pnrnrs mama Fc:ua- cow-rauzrea. - ' X HOOVER Lfl"l":uao D . :5) 9-4.99_11 ‘E if fv F ’W* Bi!-'s‘.E-I-v:n:I£In'-ussr I" 1' J / fiimmwsaufifi MW ,1; 9. /9’? ' 15¢ 92 ?»?’:>"‘=?//~ :23- 3:t::'"...: ' '. :9 Hm: 3 rssa I §?;;..%:_ - §fi;t:::f£ !:JE ~ _ “" ============================================= ./texts/FBIZodiac3/5.txt ======= an; -\-...t: ' I,- wasuzwaruw -—s—- a::s PH Pnf3,49}2?rs9 uaezwr THE _ In: Ezcrun, FBI :3-qssgua ' fg’f#f:TTEHT{Ufi FBI I§ENTEFECAIIDfl bzuxsiaui IFLQIHTEXTF . .. rwfi sac, SQ; Ffinfifiiscfi £9-22953 x:sx uwwwquu suaJ5cI;’finLLEau.I1mEs — HERALD, UfiLLEJfl, CALIF- Rfila UQCTIM - EXTDHTIDH. .-¢ YE REFERENCE aunanu TELETTFE DATED ocroaza THEHTYFBEH, Las = ' THE IDEHIIFICATIDN DIUISEQN IS REQUESTED I9 CGfiP&RE THE Frmflrfiiwrs a2.raz wu~m_ ,,r.»~_ “-4 *4*J‘r°W-'- ITH SPECIMENS SUBMITTED IN THIS HWTTER. in. xvii? : .-A _ new FBI HASH Dc “” ’ 2% W’? 5:55? a//{fiat "W ' -. _- .-'3.- F" ============================================= ./texts/FBIZodiac3/6.txt ======= mm""2"°*”'FEDERAL umu or IHVESTIBHIDH Wcrshinqtan. EL C- 20-537 REPORT uflha _ IDEHTIFICRTEOH DIVISION - LATENT FIHGERPRINTSECTEWE _ mug F1:-_,5 Hp. 9-2296 ‘)2? Udgzaber 3.1, 1959 REfl-I Ffii TILE ND. _ LAT BET CASE 510- A_ T°= 5.»'s!.'t, .535. 1"'!:'&?eflG§.$'¢O RE: LRQTIHUWN SUBJECT; ?'.5.uL1.EJG 'I'I1‘§E - HI'.R‘a-.1I3 ~ VICTIM '1'_§ll.'E.‘.J"CI, C..:‘».'L.IE’C1RHL-. .E'XTCR'i'1C3'i' nu.-.r:;=: mac E: Telety}-.e LU-2? - E9 EXAmN&W$NR£fiUflT£D3V= San FEanC;S:D 55-ECSMEN5: {J ease tiqsl vi’. r bi,-1' ' :- ?“ = - " fie pa. prints hare arr -‘r--:-=. ' 13315 ‘=EP°fl= Cmfiims and Sup‘;-lesnaemts D-ur tele- type dateé 1fl.r'2?..='59. _5~'?u°.lLE|3 24 UST3 11953 - 1.NTri':'b1g . . _ - nu . _ _ __ _ I ;.=.1m 5.59.; 1-1:, CH!$d!|'.|l' I ‘T-ac-Icv.-1' T "" _'-I-F F:Ia.R,a:.uj U TEE _._l:§_F-D_RI' IS‘ FURNISHED FOR OFFICIAL 95$ D«"!'l'-'-T /r HML EKIUH TELITTPF UNECI __-.._-;../J - ' a‘ I. - ============================================= ./texts/FBIZodiac3/7.txt ======= -:45 3'5=_q-_. l;—E-$53 In FEEJEHAL BUREAU OF INVEISTIG-ETION L..qT5r~r_r FINGERPHINT SECTION WORK SHEET Hecmded; lU-23-59 9135 éL+!'|1- Reference N0: FBI File No: Latent C-129 No: 5‘ r \ 9-229:5 , “ 9-49~a11vv€"+ Rgcgsu-ad: 10-23-59 5}}! A-100512 finewef tn: SHE : San Francisco "H ExurrLEzIctt:ion requested: 13'3": Afidressee Gag»; to: " U'i‘1KDiC|"'Ifl:E SUBJECT; “ "u"A1.l.E'.JC|- TIIIES — HERALD, VAILEIO, CALIFDRIEIA ‘ -K-'§E’IL5II[‘t!. — E'2{'I'O'RI"['|JN FIE;' __.\,:¢:,';I*_frv“\ U-eke 0.’ r~eI-e:er.¢-3 :¢r!'.=unlc=':lue:h' 'IE1.=_t:,rPe\ 1CI—2'.7—+_',—9' Specimens: ' T-Eanled Sue: rec: 5: 1.4“ '\ He-eult oi examination: 34:. I-'-=37 .r;€_'-" Examination h~_.r: _ n_»—. , _.. - r , . Evidence m:I’aeI:1'3=—}’= ". :_‘-'._'\..i\'. 0.. x'-- . ., .~.\,,\.-.3 Ar: \~&‘:':‘i—.-‘-_-‘ .- - f ‘ -' J: _1_.- ifi . Z‘-~I_\_-'-~?.»-—«jI.TJ E-"LE1". '.-..=T3,‘: =2‘-:l~.7-F '-"-r-"°','~ fir"- : 5.; r . '-e '1. . ,- J.;1¢* E ._..a '-.- F _:‘‘\u ° 35:.-Ja t_:.i‘J.._‘] , .- .5 .".. 3.9-k '_: _ _r_' J". ':'|"J .:,_ _ _’;__ .r_x.-_ _%Hf 'Q‘ 1‘-"J Dictated . 1.1“; 3:3. ElHll:1il'.|E|Et1I":l1. cugnpleied Time flute} _ ============================================= ./texts/FBIZodiac3/8.txt ======= iu’#uS!-iEE'?GT|.'.|i'e'——3—— 5:c'IE ?l‘E PST 1!.-’.':u'.-’_6‘§“ URGENT T'2"3r' /{d?o: ' b REETUH. Fax (9-4S91l)(ATIfi.: EQEHTIFIEHTJDH n1v1s:nw§;-"l ' MJEI .1-SRfiMEfEIIJ (9-53) {.='L_n.1r4T_zxI:+ - -3 FROM: 5&6, FIDJ F'RrJ.?¢CIS|3G- (9-E296) [IF]. $UEéECT‘. |.J.'HE.i6UE'§1 SUB.JEi}T; WLLLEJG TI.'|'|ES—HEF.‘I-'uL.Dg VELLLEJD, EZ¢;LiFUR<'EI.¢u - UICTI-H EKTUETLGEE 0'3: Ssfucfi‘.-°e9‘.E€4TU ff _,. K HE S_£uH FRQRCISCG '?ELETYP£ TC! 35.3331‘-'|U-, TE!‘-il,-‘THREE Gififfiifi ’NIHE. THE IDENTIFICATION DIUISEDM IS naéuasran TU cumaaa THE _ *F1«fiEiPR1nrs. 1? LucAIEn, OF THE EQLLUQIMS Tam SUSPEETS uxru ‘g5 LATENT ss=§c1r-mas PREUIUUSLY-SEJEMITTEEI In In-I15 cuss: - RESLDING IN UICIHITT EIF MURDER SIIE OF‘ L.J1TE2S1:'l?s‘.fIC}‘ll"i, >7‘ %/ ill] —I— /-..... hf .,:fi.‘ .-Ff .9‘ .g Jr}. 1. @ "*3 S!JI"ELp ARNED AHD DQBIGERDUS. ============================================= ./texts/FBIZodiac3/9.txt ======= 1.95 (an. I:-H1} 5) _ - FEDEPML BUREAU OF 1T~WE5‘T!GF."l'IOD_{ L}-TE-NT FENGEEFHINT $E.'C'T§C‘N '-‘FORK 3]13ET Fmcfidefl l1—i—fi9 9:15 a.m. Rflemnc&fib=9fE?§5 2 FEIFflsNm9—$ 1' P.-2I:5:i\'£*dt 1]-.—’l4~-5'9 £517‘. mmwarm:EAC, San Franciaac Examination Iequestad by; -*'!'fi"‘-U155 5&3 Copy to: R5; urimomw sugmcr; VALLEJO :~I1m—HEm1L:n, w.LLEJc-, C!'.LIFORIflfi.—‘-TCTIM EKTCIRTIDN [me at ;g§.9..;n.=g communication: Teletype; Ii’-3?-Err-‘J-ea" 3. 1953 Specimens: Named Sue eats: u;""’ 3' _- V .--L..1?:f ': .' Egan [1 of gxaminatiflfl: _ EII:[I'.I1il'IUtifiI'l in ' Ewiderpce =u=-t.=_+ . _ AL _.".I"’ L -r I J ~’r »« ‘ - _ i"]IT_J.-gfifg Examination ccxznpleied _ G Dicrtnite-fl - - . - nae El 9! El 3 ============================================= ./texts/FBIZodiac3/10.txt ======= 11-'T-69 PLAIN T1311 '1"ELE"I'YPE URGENT :' TD: SAC, SAN FRANCISCO f9—229fi) FF-UH: DIHEGTUE, FBI (9—“3e991.1;' WEBB‘: ';%.M.I.EJ':) TI?a3s—:LILm1.n,'-' .v.n.LLsJo,' GALIFBFIIHMQ.-VIl3TI1'[, EXTERTIDHL -3,? 413‘. r- EEURTEL NUVEIIBER 31:: mar. LATENT ‘.E'IHGEP-P1‘lIN'I".i am: 11513335310113 ’1"HIS ans}: HUT IDEN’l‘IC&L orjmm mm _f-H . xjnowja-B1 mm a._, — “R W“- no man 1:-nrlrrs may run -ramam IN‘:-1lV;IDI|AI3. -HY BE mszrrxcu. IRDIYIDUAES ammo EETEL. "0 P¥"“E“P“1NTS W“ “E5 ‘W- GE-G,r"1n: V {5} Hfiflrfifi (if » %’ ii.:.:_..‘3= 273;» I9 :»:'n*.r 7 ugee F-elz EL; ‘°“ '‘'||il:t1 ’ . _, /"/Id’ ;1rJ| ' N rum?PS an IE/ ============================================= ./texts/FBIZodiac3/11.txt ======= . I1—”’ teletype llffiffifi Examination {:1 Evidence noted, 1;! Z57?” .r.7‘c;;, g-ganééwfir - -'9’ Syd Diclubed, _’/.5 4 Dcrlc Date 9-a.9911- =3‘? qixi /2 fr"—~£.§ - #2 6’ ‘LME,.r' ,.éM,.z5" ============================================= ./texts/FBIZodiac3/16.txt ======= orcnaaa {I2-3-D6] _.<' ' . (J EEDERAI. BUREAU 0!?’ ATmN FDIPA IIEI-E-‘FEE? PAGE flflN SHEEP Pa.'a+=(=}u'ifiIhElr1aJ1ir£I:sumia|an:afioninthefi1e. Ummmmurmemnnuripguamanmau, whamixuficatai, 1-.:q:r]:ai.1:IllIizdr:Jua:i.uu1. ' El Delfl§mnHHemad:mnumtmmeu.mp&ommfimmdba¢wwflhms$$hhmahfia]'mwhmefiu mic-we: Loyal. ' sfligg 552. %' 5523 El (I:-3(1) _ El {UJIL'DE.*\} ' Cf {dJ£5} El {HIE} D (U3133133) El film El 021(3) 1:: (h}t?:I{CJ- I3 I.'kJ{1} U UIMTJEDJ El {W33} U cb:nm-«:15: ' El my El CIFIIUIKFJ _EI £|EJ{43| D fl:'II(4I| E1 Eiflvtfiil _ E3 {MISS}! 13 +ib)(5) El mm _ E|_[lc}(|S} El {bl-{I5} H mm 13 hfiTmMimp§IEfimd0U.!j'WathhflpmUwiflmE6f¢mn.fi¢mm:m]fiuuufyumIDquesIDrmesuhibatufyour reqmzstisljsmadjnthsefiuaonly, I23 D_c~mJma=14x11figE;ua£$dwid2auuLh.:rGum~u11:J;a1:zagc::¢)'fam}. Thmednmmamgwemxfinmdmmmagmgyfigp 1'0r=‘¢"u"i-€'a'3J1-|511ilEI31fE$p0U$&lo}rUu. ' P3-3‘fi$%>0nTai|1i.nfUFmE!iflD.ffl|fli.‘3h6dhjv3und3tx Gumnmcm ag-;m:;.r('u:sj. Tuu w1'jJtIca,dvL9afluy:meFBIag mmgetmahmvufwjsmmsmaflmfiulmnngmrmummmugmmmamwmg-gag). P3E3’[3}W'i‘31h¢l|5'E|l&5I1I1d1 fi&'5fl].flfik Jusnnt baeumafig. ‘fuuwijlbe mfigefigmflg dispnsifionataiahardate. - -1 Pa.grruwu:enu!om1:ided'e:1f0rre£¢aseasfl1e5'arcdIJPl1:;aLia-eaf 1- - ' :1. E'a.gE»(sjI wiLb.h.eJ.:1_r<>r flue fu1lUwi.11,g1ea3mJ.{:.}.- N Tlw 1'01lcw'Ingmm1beI fistubeuadfmréfkqpqexeggxdiugfigsa pa_$:-3: r F‘-£!_,;::~‘_bL ‘I"-'5" flDGflXflKK X Belem? 'Pag9{sjI X ‘r: Nu I'.‘|'I1&‘Il:iI3t'Lu:rI. F: X K for this pegs X }D{KK:flEKXXK XYXXKX XXXPGEX XXXKXX . - Fauna; ============================================= ./texts/FBIZodiac3/17.txt ======= ‘(J ,5 E . . - ‘L é ': mm. E3. 55332355 gr 5? - ' . +~ ridwiszé 91?)“ F 42Er=r«r- !1—1E!-63' PLAEEIEET mac ,:,-urg«>szg»9ra”F.-a’_ F-e Biff; ,'_g ._ . -r;.,,q pm‘. 3*: a7{.=?«aj»€ * j. _ T0 DLEEEIEE (SI--199111! £I.T'J.'|'-1|. 1nEwI1Ec.n1ms-nIv1s;cm - _ 2; _.:,.¢.-Hg;-,,.,P ,.;.-.s-mgr! -§.~.;a f’41H-3.?-E-5 /_=' URGENT ~:]—-?fi?i*’='=* sf ::1L,I A-4"; ;r-ra'-:E-‘! % '?'-'3'"-‘E _; J.-I‘ r'.'.»‘.|9‘E' ;>F~_l"j=-L-.§_‘-L ' . I"-'¢"*$-_g ' , '-J REPORT :5 Fumvrsrma FDR arm-::.4; use agar :Lw:;E£UF Wunfi:| l 1'» H QB ============================================= ./texts/FBIZodiac3/24.txt ======= (.";5.| .....-v. --M -mm w-. 5-as Inn. J1-e-53! PEDEHAL SLIFEEAL1 CIF IN‘-.I'E5TIG-.3._TI|.'.|[\} L-*-TENT FINE-ERPRII‘-IT SECTION WORK SHEET H“-"°"d'3d-= 11"7—59 SE55 3-H. Reierencé No: Case # 2,43 14.5 ' ' -4 - 1‘~'BIF'1e N : 949911 3 REES-‘Ned: 11-7-'55 gal] L¢1$fl:-tag: {gig}: £__lu.G,42 .1; ;LJ I A?‘3'''‘ET 1395 H-1'- J3-Ck E. $‘ti._1'l:z, Chief‘ DIE Police, Po Vallejo, California 94590. "Attention: {Pflfit Di‘-E5-CE ‘Box and Zip Code per envelso Examination Iequqstgni by; ,]J,d.|j]_-35 gee ' .r rm-mcnm suamcr; w.1.LE.:m TIHES D m11.1.E.m, II.‘£.I.-I IA Bxwomxun CoFl'i:I:.-" EL,.5"a..._/'3,,:5':_:_.4..4,pL¢¢:lf"~’;?‘~_2z,~:-"_5,j,T RE: Date of reference :O|UEI1|.1ni<:Oti.On: 1,et-tar Qntoher 31,1959 5132 I : - hi? _ If?‘-" Ex-:.=:nim:I:1c.n L5»: - Evidence nated by": Result cu!‘ cxnmincrtion: Mwt 6% »«w='J . % V % of’.=u:- ;v'1.._.~;.,.,..g..¢ .;«.,;,u;.': {“_m{,?&_;/),, av-*- . ’___J)-"!_.£_J»"_{.,.9' .-. ‘:2-’ .*"$';- r%5 . ll./_"_2r=¢«“:_ fléfifl Dir:-tqted -rfifitn (:3 z 9 t 15 .-:42-"3:-— EK|3U:I'laIl'l{lli|:n-I coumplgtgd Time ============================================= ./texts/FBIZodiac3/25.txt ======= ="=J'1!HL Eiéii-1.1:! or _h c2H:¢afirs°;“€raa§*9:'1%a W . DE3T31'i¥iES Ir L . ._'. i R-15 2-11‘ am Pa. 1/ _, - ‘fix; ' _____ _. E '2 DEFERRED 10-an-59 §{!kE}hC} —§ 7a D£§EcToH _j: FROM 53 RaDSTfl 510535 EU "mi ;. ii , “ ;S HTTN LATENT FINGERFRINTE g 'FUTHEH LNFU fiVHIL. REFER mn?n so FILE 105907 ):_,/ gfinm FRflN.Pfl 595514 UHLLEJU PD FILE 245145 zusxac-Ham1c1nE..susP. -—--fiE”r‘i'.Fl BET. sa1*- 'b"?""‘ REE‘ 53 EAEL-EARDUL SHEREFF NA?n cu. CfiL§r" Tné nvus Pa 2'13 11!‘? DEW ============================================= ./texts/FBIZodiac3/26.txt ======= 3-938; -in-on-. L2-|o.gg| I B -' - I ' « mu-.. 01:1-ih -.__«.e.—~.-'-H-'7— - ' --' - - " --- uu‘u;s'ni{u€E_i1'-a51,.-Ln. 'c."- :.J'I':ié'§*?. _ n_j£Pg;_n,.r tnsurlrrcnrmwTi'!'ii‘i'§i'tiii Lh‘%I'-INT"?-']J'fBERFfR|NT' g,.3E§;'§A_7Ia_u:~- - _ ER ii. "‘.l9"flfl_.= Asssmnr — ummnn - nEse-H£e.-:"E,- 2' ' EMMMTW H$QUEfl Ocdnber 31, 11335 ac-1::-zmth-a: uuhaoou F51 ' ============================================= ./texts/FBIZodiac3/27.txt ======= L.3x_I¢:=_w. L1-E-5 3] 4- FEEJEHAL BUREAU OF EN"a'E$?IG.5xT[C|N L.F'.'§'ENT F]_NGEi-_l’PFl[.‘~!'[' SECTION WORK SHEET Hecnzded; 10-31-59 9:25 51.13, FIefe:en;':::~ Ho: 2 Q . E‘E[F1le No: " $—¢E39ll *4 -5 RE'~TBi'-'9*5= 15'-31-59 am]: Lucllsuiflctse Nu‘.-H‘ ;‘1-1{i|'D‘§=2 hmwg; to: ‘MSG Case ii 10590’? mi gwg. mu._.1.»1 <_.'.~,.;..»¢*_,_ g Aha; "E-_----:r.,_~;!.w,\3,'-._;_-L__ .-au.=§:;',%.' . _| mi».-.::-.-1~-, 553*.“ - Exuminutian naqueatmi by-: Jhitirlsrasee 4 F _ ' _ ’-"L 11$. ‘E’ 5"" ?"‘L”‘V"'*“ 0' '_ ill‘; 5" "°“;""*-"':§U‘§ -*-<-~<;=31—F-'‘’‘’°';.? {.9 '1 a_’,' 1 Cup? ta: HE: C, - L. LIA It 3 —'s'ECTI.5.ES; U! -LA:-:3 BERRYZESSP. AREA KPLPR |:|:|L?I'."IY, CflI.'IFC|R}.‘fI;a5. ' 5E1"‘TE':"‘-[SE3 2'7, 195? ‘ 5-_SS!!sULT - 3vT'I._T'._~"_:‘"3F3 Date of tefexence comslunicutiun: —’P-alizraw--?.£§*—3»—J:—F§43 '5‘-?»'«'—;l-'='<:-Iv?-'“=~'~ ¢\r"-:- :3-.-:i~..'_fi5g. 5.'2.r£31}f{3?|"';~ ' Specimens: flamed QUE E t- T- W1 W-' Result cl! examination: E2:-ccnzninertiun 3:3-: — aaféég M. xii/:..« ::=a»f'” E'idm Wed M" Q . ",_"~cJ~ ' ,... ;. - ~._s___;;__ 5%,; -5 , 6. ’a.e'TL,l':g>4 ‘~’;n.r.";u «—l - ‘-3- .~ «*1» $ ‘u’1‘-’-i -11% H ~~ ““"*‘a*‘-- - A *3 “’ ‘ — ' 2 --" ' - . ' - :' E‘»‘Jr'- ax .Jk-'5-:'|'LI":'\r-”" /- Difitflled 2%‘ 5 3, I 5*? Ifi - ============================================= ./texts/FBIZodiac3/28.txt ======= 4.‘-'1--.25 :_='. Icv. ', .324; -1: T;cI."_an21'Lt the Io-JJ-owing in F 3 I Gala: 11:12-E59 _r3":r::-r -'n..-drier-x-' .:r =cu.£—:-' ',"i_g L -EMSD — g;__.’|’—§_IST',EREJ.'.| ' _ (J7.-_'.;r:':y_,l TD: ntascmn, rs: {9—|4EJEl1l] I {EL-t-t: FBI La=:aratc.~*r;.r, SE? EISDBCIEDSB L§.., Latent Case No. A 100-1+?) FE-€CI!'1.' SAG, Sa5.N FRIMJCISCU E3-2'2‘S‘fi](P} U SUB; ..= .'.'_ Ell]-@343.‘ Tifltéfi - HE=r‘al<1-.." ‘Egg ‘.i’a.'L3.-2jc~._ California — 'x’IC."J.'I?1 EXTCIRTION -- z-3 5 DG: Sacramento L.-‘:|1.|']-q'D""]‘ fly 5- , 3:» $5 ;.' _j—:E is San Francisco 1."-3-1=_-type to the Bureau, ll.-"1UfE-El, iL— -E‘ Enclosed herewith for the Bureau are one (1) photocopy and one {1} 53¢ Xcrc:-: copy of a 5-2-.=en—_aege latter and envelope addressed tc "5-an F1."a.r1cis|'.'¢- Chronicle,“ San irancisco, Caiii-'._. postmarked at "E San Franciacc, 2I.1a'8f69,. and vane (11 fbhotnvaopy ant! one fl) Xerox copy of a thr-aa—_:>ag:_e letter and anveiapa addressed to "San 5;.-3' Francisco Chronicle," San Francisco, Calif, postrrtarked 11,-"3.«"5E at] am: San Francisco. Both iettars ~'-Jere purportedly wt-itteh by the ' "ZDdi.an:" killer. - Enclosed for 1:?-:5 Sacx’-a.i:cn‘t'fl Di-«:'a£c:', is age C.?.J H-=_'r'cI:< c-say of i‘--5 each of the above. 3 cHa:jab _ :53 it; ,5 . . 11* *‘«D9mv=-5: Sent _j_____p.1 II’ On l1)'12.-'85 Inapecto Hcam_icida Detail, San b1CrFrancia::.o PD, furnish the enclosed material, noting that hath _le1:tar-5 were received by the "San Francisco Chronicle" newa- - =pag-=.~r' on ;I.l.r'lCIr"E~EI. it .. Hat‘ an ? 1.5:. if.’ 5......"-' -,___ ,'_-i'._ -.-I- I Bureau (Enc. um:-.mau—an; _ ~* 119 .—srecz- 1-~<~= — Sacramento {EI—E.e}I{Enc. EDEN-‘[SD—RMJ . 2 — San Francisco Q‘ U. .F'.g-em in Chntrge ============================================= ./texts/FBIZodiac3/29.txt ======= SF-‘3-2295 cam: jab REQUEST OF BUREAU: The FBI Laboratory is requestad to_compare the enciosefi letters and envelopes with preuioug material submitted by the Sacramento and San Frsnciscc $iv:5:on$. The FBI Cryptcgraphic Section is requested :5 camp cipher contained in letter postmarked liffiffifi with cighar pre ly Submitted by the Sacramento Divisiag under date as BKSHES. 1: is requesteé that the Cryptographic Section attempt to de—cipher this message. ============================================= ./texts/FBIZodiac3/30.txt ======= A_. Q. ., .. .. .._r_......_._. .!._._.._r .. ._. ============================================= ./texts/FBIZodiac3/31.txt ======= wean ============================================= ./texts/FBIZodiac3/32.txt ======= rr' an?-ra Jfi-51-S9 unagrrr was TU og,=r‘r':':run {Q-49911). mm ssacvenecsrero (9-53)- nxm 19$:-sr. BIL-‘I51-3!-i. FROM saw Ffipaewclscu <9-2293} ' Pmxntzxr 5.: um-zwcuu sususcr; '-'.-!u.LLEJI:| 'Ti.’¢ES — H£R.e=,L9, u,_&;+_Lwao, Cfl.LI_l_"- H-r.':.n. — UICTIP-'2', E>{TDRIICI.W, 4:-0: sacnnmamro. HE Se'5lUR.tuI"'§EIf'l'l‘I.'3I i1JIP”‘?EL TD SAN FT-IAHCI SCIZI GCTGBEE T@1'ENT‘t'IiiI5,'E . LWST. _ THE £DE=-‘£1'I?ICATIUP€ uxuxsxau £5 REQUESTEEI I'D I3I:]?*‘s.='a'1.a‘-.'E Iiii __ -;_l -‘F FIEGERPRINTS III? THE FULLUI.-,=Lr4u:; my SUSPECTS HTH ma LATE.’-If S!-7‘ECJIs"1E_NS PREIIEDUSLY su2:=:1IIaa IN nus i‘1=*-xE'TEfir — '5? D_4amr_+: 1m9Iu:uu_qLs's 9-tam»: FUP.-_'4I5!-€i‘¥J 595.;-1 FEAHCISCD P-GLIBE DEF:-U-.‘TMEhi3.' as PCISSIBLE 3Lrss>Ec:r II‘-I 2022145 mukuzns aw .:zr-‘.=-‘£2359; ens? SHERIFF'S :2-.»*-:-1:: .aI.J=-3a.:~.u:.._ 1:-.u.r5sIrs;:~im.I av sq;-4 me.-.'1:1sc::u POLICE aarnazrmaear Has 32*uELaP2n_m.~., =;-05 .I_t'fi-IE!-‘IPEILIS, '-”‘F*“’-‘*fi'*="T-‘-"- “3””~'€”L* END F'.£|5E 0935 G _ __i-}_ __I _3\J:§‘_‘ _‘_ - - ,- " __ _I§1 .-' i7 ’- ft‘1/79"-:‘j\‘\.-.~. 4.? F // IE E-ii".-"I 1': Hf vb ============================================= ./texts/FBIZodiac3/33.txt ======= Pfifii THU ¥HEEEfiEUUTS UNKNOWN. SUTEL. QRMEQ nun 3fiNGEEUUS. EH3 3.11:-'1‘ F25-I am SHE": ============================================= ./texts/FBIZodiac3/34.txt ======= ‘*j‘f;*f?__EE_DEh.il menu or ' mve;.3:s:.rzou _ 4 5!.'.:;!;:':1q:o:I., ETC. 2053'?‘ =3 ‘‘ .w Hr’? 1”’ REPORT ,' of H2: IDENTIFICATION DIVISION LATENT FINGERFEINT sficnorc - "j _ ' . ”% Terr: I-‘nu: z¢cu..- —,§_-£295 -N 5. -bar 5. 1969 "'3- :-i‘?‘EIPI-TE-‘Ct-1.0:‘.-E-)E.E{:_E&: 9-499114 - . A-I'M . fili, "' FLE: " mania: straJm:'z*; I -- w.::.E.:ro In-as - mm _-_;§—* ‘|uT£nIl.E3D. CAI.IF%liI!| - VICFIII mroarxmt - -§ : ,-,so J % :15 Fan sacs: -3: E T: 3 ,T_ g}etype IUIBIIS9 3 ,,.::.:'::;,,3:WM U“ W San Franciaco am. This regrort supplement: and euhfirm Latent Fingerpzlmz Sectian teletype 1131359. Lat:=_-at fingerprint: suit latent lmpresainna 1: o ed this ' --H_?_.. ..._... .- ;; 1. ' John E~9<.H.I D|I'=I.=!Ir ‘ ============================================= ./texts/FBIZodiac3/35.txt ======= .'n-;.. .-mm -gm wn.-' |.-'.'|6 {RA-v. Ll-E-531 ‘- I I‘ -_ _ r ' _ .*~-- ' ’ FEIDEil'-“..I1J_. BUREAU OF“ ENVESTIGATION LATENT FENGERPRINT S-ETGTECIN WORK SHEET Hécétdvdr ]-=1"3"59 7:53 a.|:I1. Rea-Ierence No: 9"22g5 _ FBI]-"lie Nu: 9—=i'3'9l1— ,3 Received": 11 '3'E9 PJC Latent Case No: -55-100412 FI.z1.5M=_‘( to; 543C; San. Francisco, Examination requ-sstsd hr; $dd1‘e.~5.$.ee cap, pm; 59-0. Sacramento RE: tmmown sus_rEc:I; 'v'.~"—‘,LLE..TG TIE-‘IE3 — H.EF.£5J.-D "'1-LLEIFJG, {'Jsl.'EFURN]'_$ - VICTIM EJCEDRT IGN " Date of re-59:2-I:I.':e :v!:!rrw.niI:::Iti.cIn= Ti]-°’—‘t_*,i'P€ , ‘J-3'3 1 "$9 .S_l:IBcJ'.mens: Named. 51.15 -acts: ' DUE 1610’ wt-1, no I! if it . |i ya’ ‘I-- -453» = -. -__L_ E. H3,-5u_li ff examination: '_¢J:' '31 Examination hr: _ ,,' <'~_:,,.__I._ - ' ' ' Es'iclegc-*2 .'I::I|.s=:| by. _ ._._.‘._.'._§-C .£> e-+—-= .'=gr.. - r- . -. _ * -.- 1-’ _, J: ._ “'.~__:_',-__J$5-T.-4|. ‘F;-:j~_ I--' F-W7" ._-=-': 1:! _ie'-. 1 -- _ _ A-_ _ ' _'s _1-' “+*—~’%?*=*-3"~‘=-~=- - ~> - :- mfliaaqj-¢@i¢.w’.. 61°‘ ‘J A rm-—4,4 "e--I-i'£_F_2:lf-4/‘t’ 6”?” J1,-e-fin‘?-‘e{(-I-"’“"z"“j"'..I""" 4.‘?-L/,-?mp glgbfifij J ._ F/I Exmhinfltinn cornpi-3-led I‘?-“ID? 5’ Dictuted 9'5" D? 7 R, l|IlE' e .1 9 ============================================= ./texts/FBIZodiac3/36.txt ======= ============================================= ./texts/FBIZodiac3/37.txt ======= éazvr-’ ’ ‘ea: ============================================= ./texts/FBIZodiac3/38.txt ======= asy§;¢;vgpL£d‘ggfmsg-H5aALafi}%uaLLEJn;*CfiET#URflLn KTGRTIQH. 4 2 ;¢_ :h_ '-g}fl_ -. , Hufiu : - -- 37 . as say Efinflczsco IELETYFE wavamaaa sax LAST. Infiuxrfgcawgpu atugsrow Is REQUESTED Tb cEm§qh£ THE IflGERPRIHTE*UF hqizassgeazo ¥£§fi IHE ' -LfiTEflI szussapnxmxs Ffizu19uéLT §UENlTffbqi# I __ $3 - _ __ . _ . ‘'4,-_. Elm "."-.:P _ ' _ ARw'DI §E'naMGgEeus. ' . K. .-':- "" 5 THIS C5‘-'uSE ,“ 5 —i --3 ============================================= ./texts/FBIZodiac3/39.txt ======= : ?.I.- go;-. |-v !--GE ificv-. :2-5-98: _ : 1.3 - :, FEDERAL E-UREFLU OF IN‘\"EISTII$hTIGN L-5-TENT ?lNGEFlPR!h"? SE."3T[C'N WORK SHEET F-'&I=I:rc|e<:|: 3.-1-153'-59‘ 3 :90 &.;T|.'I. Hgfgcsnce No; R __“m_ £1 _ FE!-I File No: I-!|_~§_4i_1__[ 959: - - FL: ‘I. E-rn1:_ La:-bent Case No: E _ re EMT Gk- énaweito: _§.€3u,L. 5-"=L~.-‘t-'I5d.»"s-/~«it'v.:,L_a_? -£1‘ E:-mminaijon rs.-questad by: jx}.-J pflgégylc L5 L: Copvio: I FEE: t.-35.5»-.;s."c... i<_U.fl{LL F3. ‘I; ': - ~» 5 l-*1:§_~,-- |i1°.’c‘w5:F—.:;; ‘uI’9.L'L.‘52FD_. C..:5c--1?-¢'?«f-*'u‘+ —~"I-c.'nr'-*1 . .1 €x~;ta$T'I-an-" Date of r.-:—Ieren<:e :cIfi:!::,1.:1iI:qt[qr_.; "[f,,,__£ -(“,2 F; H. 5-’); £1 Snecésneng: P53»-1.é’~n flu" 3%: T b,,{, Fiesuil. of esnm~zcAL ?:rEGEi~rPRI,?-:"I‘.S a:J.1: ;m.— W Two m on !.:EAY NUT BE-<'AEr!iED RETEL. ND PALM pnrms ram: FOR '4' I91» F-"Il‘H:1ws E5} "'5" Zféfffrr — 35/ ' ' 1 12 _|1E|:|'f 18 E59 ‘ ' :'::' ' "‘-I—u. Séwpqj . EH0“ 2:’ , .31 . " _ -"E HAIL. Footie’ Cl €E‘Ltr¥r5 LIh'j1' ============================================= ./texts/FBIZodiac3/43.txt ======= K yr ff? 5: "E wnsnxnarow -13- F l215PH -' :1-15-$9 usagur ELF : _ ;J Ex‘ To DIRE 1ua (9~d99£1} aywn: IDENTIFICATION nlulsfuu LaTENT casa a amen: CUEE ream saw Fwnwsxscu <9-gays: c?) JP .1 -jéEOD[AC, EKTEIRTEDJQ , EICI : S:='lEF!|1fI1EN'E'|3 .- % g Sfifi FRfiNClSCG FBLECE 3EPQR?NEfiT CGHSIDERE FULLOEING j _ 2 .__x'. ‘F; E IfiDIUIDUfiL PRIME SUSPECT IN IHETAHI CASE ANS REQUESTS 1 I5EfiTIFICflTEUN SLUEEIOH TU COWFAEE HIS FIEGERFREETS WITH LATENT E§flGERFHIN?5 PREVECBSLY SUBfiIT3£D IN THE5 NHTTER. =»-HIT: MLE, .f!.§‘i'£F:ICA?I, :.—*.c»a_+:— _*51 *=’u""5E=‘— SU?EL- E .flF~.':'“ED MID UM-EERUUS. ============================================= ./texts/FBIZodiac3/44.txt ======= 3-I5: fE—.n-. 5'.-E--E-Ill . ' 3 FEDERJHL BUHEAU OF INVESTIGATIUN LATE NT FJNGEFEFRJ NT SECTION 'nfC|RK SHEET Retarded: ll-'15-Eu‘? 1-TED Fi_eIe;grJ|:e No; 9-2Z”}5 FE!-I File No: ‘.3-'~499}1 HE:m?iI.re_. Enclosures (2) (2 Lab re;-art) " -- Sa r£I.mEnt»¢ (B-63) Eclosures {3} [3 Lab report} <‘~ J, [910 ...-9' J ..-' JNDMINISTRATIUE PAGE ' TELQWPE UIIT ============================================= ./texts/FBIZodiac3/46.txt ======= -_ ;_5..«,-.-,,-.:\;.-;;- Tr: :;»:r.:::-.-'. .' --.=~ - _" _~ 1 ‘Lye +_ . 1,4’-‘ .._I;_ I-A-§}D:.B-:5-'-1'0'1iY __n_ FEDEHM. EUREHU [IF IHVESTIGETIEIH J_:' WISHINGTBK, D. C. 2flI5£I5 I .3131, Ear. F:-anezsm (9..22~9a3 “W fiaveaubar 19, 3.959 -TL.-"WW3: a'Jl'B-u-'U"¢-"‘- -=-== ‘Vallejo ‘fines - Eua=ra.1ci." ‘ _ '—. .Jl'.l£II: Cduqr Nuelrar, 5 I_rJ;FI¢n' Ezstorhian DD: §___ég.g:1 F53‘ "'* -‘-'=- 1:-491114-::,5.3 5.2.. ER“ '_‘.I:. --.. Ex-u-ucl-:-mic:-. :1‘-':-.-:'=:=a-xi ‘:1’: gig‘ _ éirtel .11x'1.‘-_‘f5s5'-" ” _ tvocum.-nt - cryptanalysia .a E13155-(‘.:!'.‘|'. '."-".3-W"=:N": -sf I-.r.-.-=r'.-:: ii’ "F119 reraults of the arsptanalyais examination will _7 he fuarnishefi in 3 :7‘.-E.'LlI'LI'£|.'Lt‘ rvgpurt. ~ rm:-.53 za | -"3 -i 9 (‘ll {'71: rm-'15-1959 9’ _ __M-____g_f/ - Eacloslxma {2} {.3 ‘Lab reponrfl ml _ _ 2 - Saenmanto {B-6!) mcluaurazn {2} (2 ‘Lab repqr;-ti -i2:’;";‘I§B§ WWI A-DMINIETRATIVE PAIGE L-—. H9-"J W35“ TEL-Fl'V?$ WWE ============================================= ./texts/FBIZodiac3/47.txt ======= $s~=v-‘I59-‘w --2::--:17-rd. Q3321 QCEE-E QC. 555 =_. ITHEDB. HEPGRT cf the _.—-1:- '.t.AIa-\:-'$3ro::-g ,_,,..._.. FEDEHRL EUREALF UF IHVESTIGQTICIN 'I¥'Jt5HIHGTDH.. D. L‘. 26535 San Franaiscu E9-2396) Ziuvaxber 19, 1969 9-45‘-‘B11 ‘i}—E§111¢€i53 LL ?3I, Ea:-1: rgr r:b..— _"€-:. Lat. fin. "‘F&11ejo Tina-.5 - Iflrfld,‘ Vallejo, Czhlifurnifi 4- fictin; Ext-art 1011 11/13/69 ‘Fi:u3-to-en:-9:3! cf eawlape poasfnarkesi ' EAR FEAEISDD 15369 PE 5 HOV." hearing 131:5? printed armrest! "S. E‘. Chronicle Sam Fransisco G311! Manse flush to miter‘ CELEF. '§a‘~ ?§a<:t-::e::a;25I' of 2:.-:r;:-.r5m%1ng ban-«E fgrififiaé an-pnga letter, first page ta-egznaiaxg "This ia the Zodizn arpeaking up to the -and Gf Get 1 . . .'PhofI::ar;:-=9-1? cut second page at accompanying letter beginning in E3 1511113135 1 Rear tranapmrezt finger tip gun:-ds. 3:11 11 . . . Photodzz.-;r,r of third page of acaoapsmying letter beginning groups of ha-rkifi about 1:} gain ape..rt than the . . Phnstoc»:-mt’ oi‘ Ea-urth page of sncbmgaanging letter bzErg'iE:I3iI:g "'1'-ate nae bag -r:-£ amani-an nitrate: Eertlizar G. 1 gal Phntoe-spy oi fifth :3-agar or ace.-nazganying _1_9‘I;'I:9:r bearing drawing 01 human Photocqpy vi sixth page at acaaapanying latter 1::-e:g.v:;m.ing ‘the spate»: checks out fruu em: and and tn the other in IE!-.. Plzurtmaow u.1.' rarvarua aim at Q-2.-.2’? beafing message raeginnim "Tn prove thtt I In this finding, ask the . , and ending "iv csbllnctinl M siaras.“ Ph-rte-napgr at envelope anautnnrk-ad “'55:! raancrsm ca 393'!’ 9 III 1963,“ hearing hand prrintafi addrasa ’ 5.2‘. -E‘.'£3z::IHIC1..E E-an Zrran Cali: Hanan Bush to Editor" L.H5:p1b (6) K‘ {cuntinued on next page} ,J=-"5 HAIL s=.uo:'1:? -'ELEf‘|’9I-2 UNNCI ============================================= ./texts/FBIZodiac3/48.txt ======= ~.»-. z. - 7 RIZPDRT ' of the ._'n-;. I-.AB1‘.‘IEl.R.Tfl'l'I:'l' ..._.l|_. FEDEHM. BLFREAU [IF IPWESTIGATIGN WASHINGTON, D. G. 20535 ?m FEE, San Francisco (9-3295} ofin - November 19, 1959 FEI rm N9. 9-499}; n=««.- 2;{:-nmc L'Il=- aw n—e9:.117=.}5<:~ L1, EETORTIDN 59»-cI—¢n= r:c¢:--rd 1]/lfiffig K53 Fourté&h photocopies of numerous she ’ bearing ]1EI.afifi':|.'i'titti and hand printing < Eagult of examination: L’ It was not cetermiued whether the questinaeé hand E51 printing on the i ed previously in this case was prepared by K63, becauae of 3 lack cf comgarabla known E owever, GLffE:enBe$ wera auteé which indicate that robably fiid nut prepare the qsestinnea hand princiag 1 atter. flc3 is rétained. gift?) Hm. ac-on |:| 'ra.2‘r'rv: wt? |:| ============================================= ./texts/FBIZodiac3/49.txt ======= I-~ 5 . I ‘Li’: qua: fintnaayynifi-nntsnil§nekctutndfi:Ia.i'IIbonr1n[lnuu.[g_ Ullllll-H"Hfl1'IIlUfi'1 'lrI.t1.ofi . . ." Q-:31 E0'¢¢¢¢'h3f¢£LB1Ii!0!¥3'fl'¢IlflIItrifl.'IIIfl!r!'1fl‘tld'-"'-' lu::uuh¢nu1.3~-nuntunpuinnunag Ithoush Qua: flusoaqyorcigaarncampauyaagtggagaaané Q.".'31v|;n.|'fl insults at uunuution: _ hair:-ititz ih 1n:H.nai:n' tint thn quunuueuga hlndprlntihgnlflllthlflflihfitfiitilpngurud flu idly ‘£1:-:;ga:-nu: that othur :11:-utnnlu htnn ncriwd pmfl than pmgmm gag. ' ..,.l,., ' gitihtifiu fizstinlzaa hand 5|-,1.-1n'I‘.:;‘oII §hl'*h.¥u;L lottnrgmi n In an-. Quail. tn:-uuzh 9:32 ‘nu-a ruenznou. E313.-nun an ============================================= ./texts/FBIZodiac3/50.txt ======= I -. 5 ) _ , .=‘Ic-c-culur-r TI:-Inu=|!!t:i rerun . _ _ d_.z _ 4 1 _ . - --- L‘I—-=% - __."—~:—u-.5 _..I=.... l.I::i-#1!--1-;-«fie! _._ kflcx FEDERIL EUREHU UFiN?E§HGhflDfi Wfl$HiN|3TflH,- I}. G. gm‘ ffii. Hnustnn (9-flew) Dmm flctober 30, 1959 Fla-~_ UEKNOWH 5 ; _ '3“V=!—t:-'-‘"9"- OVALLEJ0 John Ed-;IcI< 2-Iv-:-‘r-r-:. I3:r-acid: Vallsjo, California - ‘i.FIG‘1"J.?§; ' EKDURTIDN 51. 9-319911 '30‘. Eacragzzarltn F5: El»-6‘9lC|2? I 1.5 11- :.::':.. "Horus tun Airtel 1EI,r'2-1;.-"£8 Exc=u=-:--J=|=.- .--r:-_--:::rc :15: Brirconcpg E:-x.-nsnczi-on m—.gu-.::cd; D:H'.‘a\z:'.-e1"_t-. K 2' 2o:u:rl.c_- :]r_; I 1-'_} _4_, '; I_.':;‘3r! I’ ‘'‘—''—--~- ._,u—u-5 ‘ , use-Ia-= 75-*5‘éfl":’ 26, ‘-SEQ‘? '“3Ii}IEz':151""" ._c=9.M=ar-war _} E«“1¢103UI-2-'3 C3} .{KE, 2 Lab re;-ort) -0-M_. 2 " 33'|=I'é'£E|1ET1tD (9-53} Euclosixres (2) (2 Lab rep-art} - San Francisco (9-2296} E1:u::1crs1.1:res (2) (2 Lab report} #51:. can . 2.. _ 7 1-J5 ~i_s*'{, .. 519 _ ,, :: -u-(-_;N1.-‘- Pg’; .....\-..'.’.;I n_L_.T:7: :F}{Tr~a”a~r2-=z{i959 '— ============================================= ./texts/FBIZodiac3/51.txt ======= ‘To: I1:-: Sb-wsmom: re-c:s'\Ic§ 131:» R£?UHT fifth: “—=E;£fiI3=-—-3 mAL.LAHUi;ad;T _.-II..- FEDERHL BUREAU DFI!VE5HGnflfifl WASMHGTDH, D. c, znsas FBI, Hnustun (9-flaw} _ :BlFs|c _N9- 9-49911 Jfrfi UKNUWN SUBJEET; ;chN=- D-E91U2?lI6 LL VALLEJD TIMES+HERALD Vallejo, California - VICTIM; EXIDRTIDH 1flf2FfE9 K2 Two sheets of gaper and one 511 handwriting and hand printing 0 Result of examination: LR this matter standards; in the limited qomparis K2 BALL 90%: Cl TEl.ET“I'§E n'.Ih'Ir:| It was ant éetermined whethe ‘E, prepared an}: of the questione :1 print ng , because of a lack of zéequste hnnsu however, nothing of significance was noteé on which could be conducted. was phntographed and is returned herewith. Gctnber 3Q 1959 ============================================= ./texts/FBIZodiac3/52.txt ======= /'-". 5" “~ -aa=c.-:.z1'_1{:2»s-96:- 5 _- ‘: 3953333 FEDERAL BURE-HJJ 01' GAfl0N FDIFA DE]'..EI'E,[} PAGE 11\IF'DH1|'I.A’I’I'C5N SHE-'.li'-T ' IP33-5:3} wimld crJ:i.1'E13' BI this I-D-flJ.Li-{H1 111 um me. 0332 ur mum at’ U11: fulluwing . _v.Ihet¢ indicamd, cxpLaiuflu's,da{a5uu_ El Lrelcuunsnwnmanxpugsuamtauncezmnpuunsiadiwxaa beluww-inannwwhlemaucrialavailahleihr zelema to wit. 531 i'b)'CIZ| 53 'l'hJ|iT.|1'fi-1' U ('1J{5J' E1 (bx?) El -l'|=-JIi'i'}l'fi} _ E‘ GEE} [1 fbJlC3} 33 -LT-'JI1'3'}ICJ U {W1} _ I:=1 -Iblffl-[DI U (3.1-I1) _ F3 {b.‘JI1'3'1'l'EJ El {kl-£3) _ £3 -WU‘)-{F3 El fkJ-{4} '3 ('=='}(4} *3 '3?I'lZ3} _ ' U Wifi} El {W25} CI (W91 121 {RM} El Mififl 13 'l'k'.II$5'} El I.IIfi:Irma1.i.u11 pertained only In at'h.'I.'r~cl part} wi1i1nu- Ificruncc to aim suhjwt cIf)rtrurmq1:e.5t 'CI1"|J1-3 subject cnt'_'_q'|:n:I.r mquast is lisamd. in Eu: tiflc Ualjr. E! I.‘-woa.1mar1Is odigimtad wlthanomer Government agancsfiesj. Thaaa doc-amantz wane t-afanr-as In mat again:-y(iea} for Ielrierr and dim-I:>“. raspursas to you. j Pages 11::n:I.La.i:1 aburnrmmiou fi.1.mi3i1Bd. hyanmhne: Govmmmx a.gan¢;2IIir3$)- You willlzuz a<‘J.vi5ec1.b:.rU:IJ: FBI as we ab: ns1aa,-aahility of was iafoa-mstfiuu following our w wifilt the otinear agcnqrfms}. Pagan) wiihhrlxi iuamrnmh as an fins-J release damrminatéu-1 has not bean maxie. You willbc afivimd are 111; ddspnaitldn at 3 Late: daze. _ é Pages wane mt wns§«i-smd for I-2|.E.3.SE‘- as-th-vy are qiuplii-afii'e of E-fffifvgf --Nr #5; 5; .I';.- Pagaqsy m'!1:J:r:]d $91’ mp EullowLu,gr'e2s*;s0a1{s}; Ell The fullm-hug number "mm ‘or. used fin‘ mamas Iaaatfling mm pagcs: T - -§¢.nL .1. . .1 K I Dclct:I1. Fee 35. K for :1:-is page X }C.'='+‘.5%'.3%'..'-Z2-i25r';}€X."£J5‘..'.3§P<'.?v{3<2x )€}€X}{}D{ XXXBEXX DCXXKDIES F|3.In'DOJ ============================================= ./texts/FBIZodiac3/53.txt ======= ..i':\‘-r.1;9_rml"‘;::_-, EASHINGTDH 5252 SAN .FF.'P.J.'vl{!-ISE-{J B1 2-52 F91 HRGEHT 1.J.r"H1fE9 LT-LU ID EJIFF-Ei'TflH, (9-4S9El1' AIFD Sn'1I,h| FRANCESDC5 {.9-229$] ATTKPE: IDENIIFICFITIUH BIUIEIUIH FHGN SQCRAMEHTEI (9-SE} F2 (J LIHSIJE: URLLEJCI TIMES HERALD. VALLEJO, i3:'-'uLIF'DE.i‘JI.I5I. - UICTIIH, Ema-mtou, on-= saCF:.:;rs+EHTo. S; 1...w znarnnufihzur DF'F'J'.I:ER'-,, mssr-:-113 rm-in mu. PARK, nzwxsau TH;-15? one no SEF‘.!tFH:.TE occasions, szrgnarz HESPIJHSIBLE mnzuxnuaas H;5.L-‘E _S1.H3EESIEIl THE,‘ sm1L.c-.a:I*r anwzzra A Paw: EMPLOYEE,“ Z . FIND THE HDTDRIGLFS CALIFCIRHIH IUDIRC KI%ER. 4 J‘-‘:5 E-EEH E5‘1PL.C|YEEI If-I 5"0SE§'iITE E‘-IETICIHHL Pr-EEK SIHGE - —J.nsr. <.F,'[_rlGEFEPF£Ir¢IS ar PARK Haaaami HHUE BEEN :5-‘§J'BM1TTED FCI '§'HE FBI LABORATORY, EDEHTIFIGH. IEHI RECEIRD F?EF'LEC1'S- g ~ ~— '1’ 75!! - .610 HE HAS FBI. r+um2.Ea ];v.Tvn1L.aBL,E KHIEIEH Jé finunuréiiifia‘"i-‘:+l::'vs"EEi:P”1ZiJ”fFwTfif?';EEi:nru1§ HAVE BEEN uamiueafiran wit Sl.|'BM1T1'E!E.'I Is Im: Li-IE‘-DR'J.'0R‘I' FDR M-‘PFIUPRIATE Haa_nwa?F1W+[E-" 3§a1%:§Es. I v_¢___ __...- Msalnsz e-menu Ss'3;['?PLE-?gl—,;;_._‘ll‘JgE 1!]EET1FII.'=.|'-'aTIJ;'N| n:u1s1m=':“’?é'nzeuE5IEn TU 1m-:ED1M1::.1' cm-1:»-:.1a zrm: Kranmu rxuagnprzzurs m=— P I - -"' Elan PABE mu: _ 0; |'!- ' -' » llglnfi. S 2: st:-9/‘ ============================================= ./texts/FBIZodiac3/54.txt ======= PEGE THU. —ILIH THE PREMIIC-UfiL':’ suamlrnzn Lamar 3M'|F’L,E£ M‘ THE EUDIAC KILLER. ‘S DESCRIBE'*i} as HEETEZ MRLE nmanlcnu, BURN- W ms? mu:-we .I:l1DRESS— 5“”““” “Um? ' END. wA...fiE|u FBI URSH Igc ============================================= ./texts/FBIZodiac3/55.txt ======= 11;’ l’.'u';"39 4,’ Airte}. I, I F .. r"_' T01 SAC, Sagraments _{=9~933_‘J ." T15 Er:-am: Di|.redor,? 1113-49911} «£34; 35505.; VALLIJG TE-E5 HERALD, VALLEJO, %L3'_F'{}RN[A - 'r'IC'I'IM EXTGRTIDH X” 5-E» Henri-B1 zlftéfiéa. Laban! flngerpriatfi -and izzsprrz this case not identical flngergmrints oi Palm g'.iI"*:J1I‘.5 with grrerwimssiy regnrted latent at here for enmparison print-E. I’h.-‘us airtel C-anfirms informafion Eu:‘J:'._i.5]1ed 5;.-.;;1 Francisco in Eutel llfififfifi. I ~— San Francisau {Q-2295} J‘-'lfi]LEI1 at 1 1* 1959 COMM-PEI 2. 4 #95? U} 'I_ . Lc?vDs u+t1'I:| ============================================= ./texts/FBIZodiac3/56.txt ======= .m-'.;m—-m;-- --1» :-;: C?‘»\'L"n L1-E--E53! FEDERAL BUREAU G? INVESTEGATJC-H L..I‘xTEL‘~‘T FENGEHP3-11H? SECTION WUEK SHEET Q 32% -<=- 3’ Recorded: 11-].'_'.I"—5u‘3‘ 91515] a.|.'|'l. F-af»a:s=_>nc-5' NI}: 2 I ‘i _ FBI]-"ll-2 No: 9—fi:.E?'331 Rec-ei1re11'_: 1-1-‘]-7'69 5Jh Latent Case No: 3-100-42 Answgilo: SAC, Qcy-a man 15:; Examination I-:g_L'u:-:.ied aw: -ggggrflsggg CWfl,,= sac, §4fl frmfifjgc f.-fixggfiéj FIE: UNSLTE>.; VALLEJO TIHES HEmu,.1:r, VALLEJO, CALEFURHIA VICTIM, :-:XI"cu1=:.r:m~: .3.-r e an cu Dqtg _¢j :eFe;en.<:e :'utn I.'.'.I.:Lin:cItI:I:In: Te 19 tY'?'E 9 hovember 14 J‘ E ’ 6’ Specimens: Rvzsuil. <31" exumiwljun: Examination 51$ E':'§d.&!'l.<'_‘E not-zfi hr: Nwvgnfi ; ‘L ' "' Exuminuiiun tomihi-filfid 1* E F Dictotsci " /J lé uzne cue Du ============================================= ./texts/FBIZodiac3/57.txt ======= ._......-.—.—.—..--.....-_.. . --“fall I . H§SHINGIflH agarm ' —:7—s9 unczwr CLP TU 3125 G3 E9-£995!) fiTTH IDE#TIFIE§T£U3 DIUIEIDN PL§IfiIEXT j~ FHGH AN FRANCISBO E9f22S6} (P) EF ? __F!-i , I . rii zanmc. zxmar1or—:. cu:-. sacsnmznrn. jg’? /' :‘z\’{_-\-..-_.. 7/ éffirg I I//,~NV SHERIFF EAFL fiA¥9UL tan}, flfiPR fUUHIT, HAFE, CfiLEF., ‘.3 THIS mus M:-UISEJJ IHHT new Hm) DEVELOPED F1 5000 .='osszsL5 syspgcx 3‘. 1&4 ?H_J.'S 5:55, 1:: 1-'.IE|a' or Ia'rF=:I DEIHIHEE} Rgmrlus TU B-ISEUISES, 1 _a;~ ETC. SUSPECT IS ‘ __ -. - - .I' we ngrrzrezm auafiisggs, ar-rs" m .._,_M:,_,_..._. , _,__ . _{!n!:LIi‘._. .5:-"J:'.¥ THE c'rH&”R I::_‘é'-*'u'a EEFDFIEGLE (/5. ‘:2. . I 104 EDEHTIFICETEDN DIUISEUE ATTEMPT FD LQCfiTE FINGEfi?RINT fi# EECURE v.‘IIF:_:=aNB cowaea uIIH MIY SUBMITTED LarIa.=vrs nus BASE. BUREAU ALSO REQUESTED TD CHECK Tfl SEE WHETHER ?REfiE IS %1_'E_,.1u~r He‘-HP-D'nI‘fi'II1NG nF‘u::.1:.::.a1.5, nun IF Se, r-mcg *2‘-. it ' ~_L__i',3’0€fiJ;E'Ri}?HIAIE CGMPARISGH w_£1‘H PREVIOUS SL|BMI?1'ED LETTERS. SLFIEL. ._ 9 "3-K’ ‘}*?f_,r_.»//_Z_ .13. ,. , "W -3. 1‘£?‘~ 1-” ;E:' ============================================= ./texts/FBIZodiac3/58.txt ======= 3“. IL-'5-E-U! — _ ~ _ ~- ' é ; 3 . _ '5 , -‘ FEUEFL-51L BUHEI5-.U UF [NVESTIG-9-TIOW LATENT FINSEHPHINT SECTION WDH K SHEET Eecclsd-3-:2: '1 1-1 ‘F-=E3 wtm Fieference No: 9‘-23295 __ Fe: File Na; 9—49aL1=¢f.? ! Received: '.l1»—1’?—69 Latent Ease No::!I,—1{!D112 .'-.7-'!5W€!='c0= sag, San. Francisco Emt=.Ii.nutiusI. requested by: San Fnilaci-ECEJ C09)’ in: Ha! ZUUIEC Extortion i'-%i:§:i= Date of reference zommunicniion: Teletyge L1-—1’]'—EE| Suecifil-ans: Named Susneett ban «ma non Result of examination: E3cq:II:Ij_rI|:|:i,-cm by-. ' Evidence mhled. 1:-3': - ~“ '1 ‘mt ”E‘fl*h4’—t”°"‘*,J"’*;""J"-'*'-4.,»-’*-*--st!‘/[ ‘T3: ‘ -JII? J _I I _ _ _ |:_§_"'!'_'1' I;;lI_‘E:I_J|:.I‘t['DI'_I completed J ‘I j '5 Dlctctted %r Ivg é I; Tjma Dent . El e i .-E- "-1 ============================================= ./texts/FBIZodiac3/59.txt ======= as-CA-an ((2-3-95: I F JDDDDUL FEDERAL 1¥UREAU DF [t’1"V.'%".l'IGA'I'IIIh"T E01399» DELETED PAIGE IFIFOHBIETIDN SHEET F3,gBI§$jI withheld eaalimly at this 1x:n::u:i-:na in he file. CI-.-.13 qr mum tlfflzlc fcrlJcm='i.11g 3 , wheat: indjcatara, explain this I§«cJn.'-1.iou. . El D€BEfiC|_I1fl- wmmafia |'.¥|l.'l.“$'l!3.U.l wW£ 3ndiG.|,'a-d 'beJuw1i\.ri,I:h_I1osa,gr£.g-3.1313 mart.-.:i,a1 a'|':!§j3]j]q_[c|j' release to you. TSHM 553 . Ef Ifb)(1II '3‘ {b3'F"]{-*1-1' U ffl}{5J U [b]'['2]I 33 CBH"-'3'C-3} '3 HIKE} '3 ChJ'|."'5J' El fb]C5'}l'C}' El {EH1} El i'b}l'-"J-{DJ El +.'|£.'I{2]I 1:‘ {3’}lTJ'lEI' 3 00(3) U *.'t|}|Ii'-"}|.'.F] El G<}[4} Ci (1:-'.|(4I| El (bII(‘3} U M13 D |3?I'(5J' U WH5} El [F:.](5}| El l'b}{E] '3 'l1=}I'$'1"J' CF Iuficrnnafian péataiued I:H:I.l:.-‘to 3 1J:I3J:\d. paJ13rw'L1.I1|:u:I ne'fi::'euu: EU 1.1:; subject Dff-'DL'I.'I'l.'EIqlJ.BI <31‘ uzu: aubjactaufyuur J.'~3q1JE:3£ is J.1'sLnd. i.1'L TJ:~e Litl-2 Duly. El Documelaxs odgbiaxui with undue: G-:rw:tI:I.U1:o.! agnnq.n:i.e.:}I. 'i']1£se duwazmm ware Iefetrmd to than: } for I-B’-u.".iB"J_-' a.11d. diced 1-uzspuusg-, to you, ' Pages mum mfonnaaiou fiumlshzd by another Genres,-ugnenx agcugcj-(i,g5}_ You; wiJ,['b¢ adjrijfid by um F5; as to rht cclcassh'Llit:.r of ibis infiormxfiuu fuuuwiuugmx cgwfltaxjou wim flu: c|fl3|:.:I: agam_-..-:;‘1e=s}_ Pase{sII wlflllmtd buasumch as a fi.ua.E nslnzass datermjnaxion has not hm made. arm u-iJ_'I,'be 9.dI.ri,g.ed 93 an an dlwositindz at a hm: dam. .’ Pages were no: cmsidered for I:':Juas1.': as L113)‘ an duglicetiwe of 83- #433; - rm 9.; Pagets} witbbnld for Lhs fl:-Jlclwtng rcamgfis]: H T318 follcmrlug number is to be used for mfepnue n:ga_rdi_11,g umse pages: |'-'?-' *r"i'°i I 3- ‘F ? ’ XXPWECKRPDQEKXKHX I Delamd 'Pagr:{5_'.I X X No Dupiicatiun Fm I K 1‘-or this gage K XK}CKX}CXX'.5{_K}:'}€}C{K7{ XXXXXX XXXKXX XPTKKKPE mum: ============================================= ./texts/FBIZodiac3/60.txt ======= 11x13/$9 pm :r1;'z’s.'>:T 'I‘ELl1"I.'i"PE DEFERRED N m: smfifiian {9—2.-295) PRH: axnmcnn, F31 {9—499Lfi»r-%+ I ZEJDI,-132.. E:~:'I‘03TII3'H. oo: gacmfizrm zmvmszn s3s=m."1*E:m¢ sxmmrmz. ~ W, »o asmme wjemn s-E magma ER mm Hzmmu E.-LSEEI 15,:-arr mranmrmnr R.E-‘GJ1.17;'-:IiI‘F|E Tms Imnnrmmn ;'a:»~.2«r1s:=:za :14 EETEL. N0 1.5.303.-ITGEY E'EI‘D‘R"I' IS HSIHG S'E'n‘B§rfI"I’I‘E'".‘l. C.‘I31-"T S-.'7!'l'..'-§_J‘1H.|.'"J_’i"I"n'}-. EL“. {LED ============================================= ./texts/FBIZodiac3/61.txt ======= ' - .7'='I:'. " - - Mr. ,5,» 1 — i'&'1'r. bl? E"§€I"l-'I3.E|1¥.‘-11'3'.!‘ airtel Tu: SAC, San Francisco (945396) From: D'i_1.'*ec'ts:nr, 2-‘BI {3—«é9Q1J_} Zozamc EETQF Tzcm Hen:-tel 1i/“HUSH. Analysis of CI",j’)t'0gI‘3I?'? amt re: cc:-n:;:1ated. .,ffI:;5’%£ «:;-zrntimsialg. mama C}. L;r=H;J_ 5:93? :_5g§ :2 was E3» yw ____ ‘ELL. 24*’ . "J . ._—-='.« )4 u.J.::_ 17:.-:'.‘1':=: ur-:r?:I ============================================= ./texts/FBIZodiac3/62.txt ======= :-u.: FEI WRSH DC av ,._, 49$},/i‘ FBI saw FEM-I ' _ 3-§’s6E'|f=i uaeznr H-E9-6.9 3'15 ' H 3;- TD n::1£_cfé1H »:9—e1s9-an CATTR: PB: Lr-'-.13} a BUTTE -"“-*5 Ffifiré S-AH rmmcxsco -:9—2296} .3? "?fiflIAB, EKTDRTIQN, Q0: Sh¢RAMENTfl ‘a RE Sfléé FRa'31§u"CI SE20 TEL Til} 3-UEEI’-'aU i'1'=."_‘I'~u’E."iBE.R SEUEHTEEH LAST. FOR IKFCI EUREP-U I’-‘-Nil! EUTIE, UN HUUENBER HLNETEEDJ, lNS?n'—‘«l*T, LsesP.—+ CFiY?TUERJ1$‘1 GNLY 1'0 HUI"-IE-'-‘LU FCER 1}ECI?HEFv-'Il‘H3, PINU Hfifi NUT EIEALT fi!ITl-I - —**5 SW5“ 3“ H” UEWER’ 1” ”‘3‘’-_ £ IHfi,’:“ HE mu UUUCH F027?‘-"32‘ES£?fG=D 1r: earssnum ma.=c1w'r;- PERIOD or Ft.E{2EIwl'J.' muam-:w {-::uc:fI:u.aER 53.5%-.~:, sxxrwuzcean. Fm: IHFU BUTTE, NURDEH5 IN IH1S_ -‘fl’-'lT'J'EF: OCCURRED RT $EILFlf.‘JU CtI:'J{'J’J."r‘ GM EECEi"iEE!'—." THEfiTY, SIXTYEIEHT, Iwh SHUT To DERTH; Lm;LEJD, CfiL1F., JULY FOUR. SIXIYNLHE, Two SHOT, 3&3 SUHUIVED; HHPR, BAL1F., EEFTENEER Tw§mTy- sEUEw, SIXTTHIHE, TWO STABBED, GEE $Ufiv1UED; AED EA; FRQECISCQ CH CICTCIBER ELEUEH, SIKTYPJINE, I2:'-‘-3 URI‘.-‘ER SHUT T0 ,I?EI5t1'H. BUREAU AUTHURETY Is REQUESTED 1'3 ;-IMFE THE sun: muzslum, M h:r.1sS::u:;'I.-tn, EE4.IEFWIE§. —m J:£I£:=-:r«11+aE HIS anszs ms: ;m~:1e4s— .fiS SUSPECT. ENE 1'0 IZIETAIN 5fiCH'$H|Z|U§'|D RHD GJFRENT IHFI3 CDHCEHN-IHG - 1? .EuUT'r[’CIfi'.,T.ZED, BUTTE saoum .q.TIE:riPI IE} BETERFIIEJE rs- ms gum rmssnr-z-::1+nE.p Anna: IF HM.|Di.=iRITI['JI3 HR? i4.¢a;'E=.'2 :=:=:1n.=?1:«;:: 39:51:-15:45 as-msuzr BE -:13m1m3n. use IeH'EF:|.-'IE‘ur' um. — UP ’-.rHE :=ussn::u|_a PE} 124 EFFGRT To DESCHETEL? E‘-.'FI_L§J=FuTE‘_[-,*-.|C-E 1*: M-Pzans THfl1"S mu; ;-1'.’-\'~I'2|.'6E1' THE HISSDULA PD nrrc;-an HEP‘. Area END PAGE Two ============================================= ./texts/FBIZodiac3/64.txt ======= PAGE THREE H15 FQWILT PRUTEfiIIBN FREE UHSU8. EUHEQU I5 REQUESTED TO SETEL SAN FRA§CI5CG RESULT3 GF ARALYSIS BF LATEST CRYPTGGF&M SUEHITTE3 BY SEW FRHNGISCU EHEN CDHPLETES. UFGN REEEIPT GF BUREAU #UIHORITT, N BEIIE §IUISIflfi HILL CONDUCT lHVEsIIGRTIDfl fiEQUESTEfi flQ0fiE. HHWED AND DANGERUHS. RIHMHIL CUFY ERCHAEEHTG. Efifi £AH FBI HHEH DC ============================================= ./texts/FBIZodiac3/65.txt ======= NUYEE-LBER 2'3. 1959 PLAIHTEET TELETYPE macmm 5 . ' 5” W91-»«.1 5 To 3!”: BUTTE REG "_1,r. J, u Hr. C!-:>ur9.$ «;"_;' may nxnmcwon FBI ua-49au§=— =9‘ ‘? ZGDIELC. E2£TOR'l'ION. ODSHCRAENTO. RE SEN FRAHCISCU TEL DATED HD"E"Eu'i!'E|ER Ii‘IN',E.T.EEFr' SI}E'T'YNI5'E. BUTTE‘ I3 AITFHDKIZED TO C1'.‘Ei3UCT INVESTIGATION REQUES'§.‘!.D BY SAN FRANCISCO IN REFEREE-CED TRLETYPE, SUE-HIT RESULTS TO BURERU £5 YEELL 1-‘LS IN'1"ERE5TE| OFFICES. CGPY H.:'1IL,'ED 31111 FRFANCISCO. 5% ..?§"_*'§ -.'-_.‘-'=.m ’_.f,i-‘T. San francisco 59-2296,‘: E?“ _ 55: NOTE PASS 2 ============================================= ./texts/FBIZodiac3/66.txt ======= 1.53"’ NdTE: The attaehed eeeeerne the much publicized so- called “Zodiac” killer who has merdered five persons and critically weunded twe ethere who survived his assaults in the State of California between December IEEE end October lfififi. An individual identifying himelf as the ”Zodfia¢" killer has been regularly corresponding with a newspaper in California. He has been commenting on the various murders attributed to the "zediee" }:11.Ler furnish- ing such details which lend credence to his statements and for this reason the ideal police are coefideut that the correspondent is in feet the killer. This correspondent among other things has submitted e number oi eryptegtems with his letters which may possibly contain eeme evidence to his identity. The Crypteenelysis Section at the Bureau is currently attempting to decipher some of these eryptegrame even though no Federal juriedic ' eee established as yet. Retei describee D ecspxer has recently 1'. 3.5 EL 3-'.'E‘5U-].t advised leeal autherities ie Cali ore of his analysis ef the cryptegrems on abouid be e prime suspect. Sen anei c e requested that as a cooperative measure with the lecal agthurities we should ever the of state lea e interviewing and to gather some bee ground data on been authorized te conduct this Levee igatien. it Vneeuffifiriy ============================================= ./texts/FBIZodiac3/67.txt ======= 2 - Sacramento THH1‘1E . * (531 ‘EH-'-23 C?’ "7"‘}'3?!'f"‘“*u§ - -I H‘ -_'—J_I_ -’ I In ' '-I ‘E "n'oP*c M43 ssrclrnzrcs F. F El -35 I9.-u. 3 -2341: T,-m1.9,miI: the Ioliowinq in a1Rf£‘.L g X -,2 -r ‘moi;-1: ]..’|..“"’ .r r.':' :5 u... ‘F Mi 9; SUBJECE : F E I Date: 11.-"'13ar5g' -{'7}-pa I'JI Pfairarexd or c-acl'¢J E-IEPIAIL fPrior|'£;rJ DIRECTOR, *e'1EsI fu3—a9~31}_) :i:(E'1'N: F131 LABQRATDRH‘ 325, (9-53) (F) cmmszu «ZODIAC '.-C'£'CIR"_|'”'JICIi='. -an; Se’-.>'.‘:R:—"..V.-'::H‘_r-:u Ra Sacrasneaito taletype to Director, ].1..'r1L:.r’59. EncLOEéfi for the Bureau and San Francisco Jivisien 293 Application for 3mpLoyment. Application for fiend, Emgloyment Agreement. Eeqveat for Eiagarprints. samples of the writing Bf Gal Bureau {Enc. $)(RHJ 2 — San Francisco (Eat. 3}C9—229G}{RM} is one copy each of each of the foklowing fcur docuaentr: -Kama-ted; «fig-BE CHTVEE flag Sent 5‘PEI-tin] -a-»'$En|: in Charge ============================================= ./texts/FBIZodiac3/68.txt ======= SC 9-63 enm enezé. Y 9 ‘me ‘anal Par ifer ie, adviseé on IF12f§9; that { _Ye5emite Pare_andp§urt} ‘ ‘city relative to the advised a TFC employee a very matkefi resemblance d been fingergrintgd n Identification Record for him his record reflects an arrest on ' -. their anal Bode no W available the enclosed Y?C emgl0y- ' ' ure and writing of He also advised L50 made ants which can ‘ 3 furni ed b adviaed that " ' then person reported D EC news and because he also observed a15G because of the a marked resemblance and further describe as a very strange acting person. - B ere Ced teletype the Euxeau has been reque5ted to compar known prints with the Letents submitted in this case. -5 E ============================================= ./texts/FBIZodiac3/69.txt ======= SC 9-68 _ The FBI Labc-rate-::y is requested 1:’-1 CC':T!'LQ3.r€_ writing with the [canon-n samples of ZODIAE pie-.ri.0u5l;.-' sud:-mL 132$. LEAD: 5:511 FEAHCISGD DIVIEIOE: £3.-.T SAN FRANCISCO; CMJIFGENIA TJiE1 advise local. aut1'u:Ir"_t1'.-as of-identity 6.5 -3 5'..'-.S§5E¢t.. ============================================= ./texts/FBIZodiac3/70.txt ======= ,r. '.fi wA£a1fi£Ic# —2?— ’ 1i§?fl DEFEEEES :1-25-59 NAH Tn. a£§5g]¢9, (9-&39JlJ: sacaarraro (9-55: PLaifiTEXT LT"?“” 11 FROM SAN Fanwcxsco r9~2236J [F EfT° ,. EKTOfi1?IfiN. ma: snceamgazu. “ FIE E5‘-H-1 FF£:9:.’fJ3IEC3 "EELS???" Ill? PI H} U] -: "1' I 1 I: -.3. u ."_-‘U 'JE-.'-1535:? :"‘-'_E".'F'."i?'T .‘<*_. ,:fi;Ag fiflfl sqczaisxrs, :3 £13; THREE THREE 51; 5:195 Fr".~'-'|_§:‘CIEC-5 ?Of_I"C? 9553‘.-‘-!Ff"f:"‘.,EE-{T {Ff-’IC=_':7. €21’ :"§§!_7=TI:"d';-5 .35:Ei:~I-‘J’ FGL.L-!.3‘»-.-'I.’-.‘-."£ ?fi??$IL'r’ €|.§_?EF:Cfi.IIfl-.‘-I Iii WHICH =_‘-‘I-5IfiTI‘?<' CUT HES ELE'5‘EI‘g' ‘l'E'_sU.F-! ‘JLEI D.9aLFG!-'."IE5‘. FEET}-I W-EIFE ix-'EFE RI.-‘IT§1' BROKER SEJTTL9. R - 2~.= — “if: ~—_ f F3555 3'{EP’.?FT$ INQFCRTE §'«_‘;’lF':TIfiI' .’JiEC| ST:’3.?§:"-‘"3 ' _'£E_ Li. % ya» zeal; my? KILLS?-!. £aas:=:cTc:£;— i<'C%?iIC‘IS'E, .=_-3'.~"_.'=:>, aanuzs-:5 . 3 ~.‘-, :fiI-$4? ax;.rm.=nT:{:-run .-mu muss znaasca 1u;m:.aT5 m.|=.I1e4 — -— - I is ?;IE:FI:".'1TEL rm: 1a£u:~;n:;:.; 'a'1TH L3ail<;é1's"I':%'i?s’r%aII5.=s*. RRI-‘:50 -'- --v-----F"""P“°““7"'°'“—“—"1'M'="—v--~—~H—"~dn—nvu—~—-F—..._. _,—wwnm—..._o—»...-u-. fr AED aguasnuus. arm ”“'l- 1*” ‘u...-’ - Haw ?3I wasa nu lzfifh‘fi£'/I .4_5: «gt __ .n1_;- - ' ‘U. . -- __ _ ___5 .__... ‘\P"‘- ============================================= ./texts/FBIZodiac3/71.txt ======= rflw — Hr. — fir. November in, 1939 W” Airtel T0: SEC, Sacramento (9-88) FREE: Director Ffli {9—%§9llJ 2 . ‘if C52‘-’.7EII-°\C EKTOREIUN 5 GD: Sacramento I: Reurtfil lljlurse, ‘ f}? f Reta; was $ubmitted under the Baptiaa "UHSUB; x./ Valleja Times Herald, Vallejo, California — vtcrln, Extuvtion, DU: SaCramgnto-” Thifi case is beihg carried at the fiupfiau unset -the: cattinn shown on this :3a..rm==unj.<:a1:ion. Kou indicated that handwriting samglas in the form of en la mant records had been obtaingd for FBI and the samples ware Qmng Eu mitten ta he La aha cry for handwriting EH cnmparison with the quaaticnsé lsttera in this sasa. kg MD handwriting samplts of have been received at the Bureau. If the samp as writing have not baan submitted, you should immediately forward them to the Bureau marked fotcths attention of the Laboratory. 1 REC 35 Z:,é{?:z/;_3'=i1» .--5 .-' -' rfi"+'§’.--a;ay,~ :5: men HGV2;195S flhfl-F94 '9 “UV 251993 ============================================= ./texts/FBIZodiac3/72.txt ======= b’?"' :-*3: Has}: DE‘. 4'- ‘ .""' P- sar BUTTE _ £;g,r""”'-’ 12m=:s: uge/Eur 11-2449 cc:-:43 - "_: In D: EEJTDR <9—-man}, sncnnmzurc, SA:-J Faint-!I:IsccI c:u-22s5:» %: ND MIMJEHPDLIS FRDFI BUTTE E9-T5?) 5P :"‘: ".7;-UDIFLG, EKIURTIUE, CIEI 3:‘-‘«I'.‘.Ei!Fu[9$El_*JI'|2I.. W HE EUTTE TEL NW. Iuzmvofla Last HE .r».cI1vIT'r— -Ina THIS BETTER. 1nm1u££:unL IDERTIFIEE SELF .n.5— rr.1:ssm_n_::.. MOMMA. TELEPHIZH-‘E33-H.'l room’. SIMIHG TCI SA -_““” "” ““E“T-‘5“—”“” 1JAlJ13H'IER mmxa mun was MQRRIEI} ID my NAMED S.|'~1'|S:{DUL§} can-rmcr HIP] Ir':['1EBIA'IEL‘r." an _THERE.|’-‘uFTEP. IEJ.EF'H|:I£‘lEI3I‘ AND xreuuzmrn ~ Haw HE man oEm1n:Ea HMEE I1ZIF-Dri.1iGHTE:E~.",-I 2 .- HER HUSBAND. STBEED HE FEET MIENEJEEI _I'llS5|ZIULA, man 19:93»: [-mjal In m1t~mEaP:;:1.1s. IH15 ac1{r+t3uLEueEmEraI uauzuusw nxppznsur man _1m=En'.~:uc2 HADE 1:: sn -THAI -IWHS HEJT FICEUAIHTED WITH. ES -'RE1FIElUSl,T ============================================= ./texts/FBIZodiac3/73.txt ======= < Faun ~.u:.H1eus'mufi-:1-:5 THAT you nnanus -—‘‘S “"9 PAGE THU RESIDES PL[tiIwlEafl.PI2ILIS wIIr=. sat-._1:u=eL,=:sm*E1=:, W— M rmauman as T0 ram: Tn. wasrcfiupuu HE sums HE HAD azcnaau zoom: HESSAGE, mum: I-:IM'1E{!n-MIEJ r==.:m4sr»,F-01.13 mm was AFRAEU was-was It] 31-: UECTI91 or zr;:-::1»'=,-:3. Sui . Paxtmzn OUT Io—IH.rr THERE was no nwuneaarxea aunxac THE HEflSDN FDR WENTINE was OPERATING It-:| ¢'iIHNEFuPC-LIS, an 1r+a1c.nI1ou HE miss ne- aunnrzan mm. END my Rsnsare Ia uzscugs 5.“?-IETTEH FURTHER, '.mE.ru:LrPmu CDH'u'EHSP.'EEl2IN 1£Er,i.'3~FSEI _ _2- _L-’ I ;» 34 FM’. ZODIAC - Extgrtign Jo:-:= Ed-u:r 5-I’_‘C'I'o:_, :-._-“|.,.; 00: Sacramento 9-»=-esu .E‘:¢.F-.w:2'.'.=;r.v.~~;-,:N;:-Mi ':~s:' qacrrmentg ::l\_691lz]-032 LL - |_a Id: E'E“""= Fxirtel 11/zsxss E3:I:l:1I'.I.-,:lq'l:'-. was-== t,';U,:- 5-cmcrks: ,/J? /éivj J‘ . HEW 9“ -5-/céaaan 6% ‘-"' F3 .|.’{-gig; -. {,9 —‘—\j‘_ . Enclosures (3) ($4, 2 La]: report} """°°’__:—'3_43;5an F1_':iEIl:'i5i'.'.O (9-2296} Enclasures (2) (2 Lab rap-art} d..- u.’-"J ============================================= ./texts/FBIZodiac3/80.txt ======= .'.-It -' REFURT - uf the um:si§éIi:g?:$4 ..:.. |:..i=n'u-1=A1' EER-T ..n_, _ FEDERAL BflREAU QFEHVESHGAHDH WAS-HIIEGTDH, D. 1:. 20535 FBI, Sacramento (9—E3} ZODIEC E:-:|:ortiDn November afiq 363 949911‘ fir D-691121032 LL '.'.-:=rs FEE FLU.’ NG- L_,=§. NC. Ta: 8:.- 11/21/59 G:--: c-.=e.-: .-:=r1 ya: K4 Request Far Fingerprints, Appiiaaaion Foe Fideliéy 535:, Employment Agreement, Yueemite Part and Curry CG;'ApplicatiDn For an r handwriting and hand printing of Result of examination: It was not Eetermiued whether any of the questioned hand printing on the threatenin letters re eired nrevieuely in ?tis ease aae §r@paruL of H4, becauee ui a lack of cemgarnble known semp es. ,¢wever, nothing of particular signific .c was uoteé in the examination which would indicate tba eae invol?ed in the preparation of the questiecec mater: 13 E is matter. K4 is returoeé herewith. Pbctogzaphs were not made. :JT 5 LEE 4 Kg! -*2 ,‘%' Han. now 1 1EL£1-rr-E own-I‘_.—l ============================================= ./texts/FBIZodiac3/81.txt ======= '.'-:1 |5=!»¢;‘i—L?—£-‘.’l I L E__r_ - 4.4; LLLDEATCI H! 1!; FED‘£R.lL BUREAU {IF INVESTIGATION WRSIIIHGTOH, D. B. Zfliii ‘lmfiffice of the Provost aaiarehal Hm-ealser 24, 1955 let Earine Division {Rein}, M41? FPO San Francisco 95-B132 Attention: 1|;-.§'.'F. L.E__iEI5.x-an Provost H191-shal W at 3* Sergeant — ‘ _ Sufifiefit; Joh 3413.11 H=Iv:»ts-est-at §ha.n1ew'e—unrt.1@y:.a¥?.Ea£n:'3:§- s a case durraatiy Being handled by this Bureau entltiea ' “ZODI&fl§ Extortion." That case invoives numiroua threatening letters nailed to seerai newfipaperfi in the San Erauciscn area. I: a Intent tingergriut examinatiun oi Q1 and Qfi 9; is desired. these itels may be resufinitted to the Edentiticatica " flivi$ian of this Breau with an appraprizte r$que£t. The submitted material is rgturned herewith. Photugrnphs or Q1 and Q2 are retained. ============================================= ./texts/FBIZodiac3/83.txt ======= E-if (R-=-. I L,—§—|.'-5|? J-..-1°’ ""'w\. FEDEEAL BLIHE.-w UF‘ IrWE:STIG,5.TIC-N LATENTEWNGERFRMTSEUHUNWUHKSHEET iT$'E*CI‘-‘ltdeti; IZIEIEQ 1 1:515 EI.J1'1- HEEB5'BflCE H0: 9'22‘-;"5 FBIFILE WEI.‘ 9—Q99i}_ Received: izfafsg 31;-1 Latent C-:52 Nu: A—1U[}.c_12 Amwar to: SAC, San Francisco E.?:t=ImIIrI.n Jequestgd by: Addzessee COP? _'=~='= IL‘ ~ 5&1:-' , Sa examento F"'3= zonlm: E}i."I‘C|R'IIDN Cute of mfg:-2.-Ice communication: Teletype 12:’. 5.-{E9 Slmcimsna: Nam-E "‘ ‘ '7’ . Result of examination: Examigciion In-_-_ . Evidence noted 1:: . " = 5/‘ aria-=~ ============================================= ./texts/FBIZodiac3/84.txt ======= .4: ——4a--- ' 6’ '. :' 11‘.Z?.-H'i ,»fl—::5—s9 unsznr :n=.cc TG /‘fiF!ECT|.'.||-'6' {9*4§'?é|13' ERTT: IDE?1‘TIFICJ5I‘.;‘|."1'J?*| HQ‘-JISIUN, " La'55TE'I-H CE! 35 Hi}. Fl lgfiflé} PLQIHTEXY ’ 55:50‘-"1 3:5.“ F:E.=H'1'31§CC| '§9"2235:' {£7} IF’ "CI"L|'-‘lN€-ED." 'EC|DI£!.|Z- EIIIZIRTIIJN- IZICI S.!!4|ZRn'l'.§"!EN-TIZI- .4’. : . :_ "‘ — - - - 5. . + 5. I- (' Hi» Ar /45? +>*‘.,:.1 IIILE CHMGED To "EC|DIfl.IZ," I_|w|JZ'¢S[='I|,_lI3l-I as ignesus CCINSISTEEUTLY ;REF£;fitS I0 SELF ns 'zU;>1m:" nzucl ream‘ ME:-In REFER ‘I13 CREE Iii T3iJ'.I~_i !"i°«§H~"-SE: HLEG, FOE 3»*4KE Gr‘ 5I?1F"L£C£TT. 4'3, RE SI-‘uE'i Fasuzelsco TEL TU .a.:JREAu,. zunv. TE52 LAST. Iaafirxrxcniinw D1u:=10H IS azauasrza TU $GM?nEE FINGER- _7;°a1r:Is, 1F ca: FILE, 9? F::|_Lm:1:-:3 T5-‘.5-‘?E-E It~£Z‘£'Jit|Us5l.L$ =,_r.-réwze,-I 1,, :'."F£r+s5F.*:=~rmr:a F‘fiE1.'II:IIJ;3LY SLiEi".-ITTEU Lu THIS {“:;'-ETTEE: /K7917; E!-CIREQ I qt! ma, some "9 '.-.Ti""§,.|5!,_. F31 nu. E-3% .5. ARMED mm DMIGERUUS. 335:7} $7‘; E//I ’" "415 ;.-,*r-- ' ----- SL;TEL' i:'1'£.Tj'¥§ SECRQMEWTG ADLFISEB 3'1’ 95:91. -Rr-' --'-9- --:ar',.__. 1.‘. ENE} ma— fi%wm%mum1rtmEWw am 1751 s.u},sH:u: _ J3 * -I _ ¥ . _,;/ _ . ' .1-2'-’ . .51: ,, .. . , ' 3- r-'.~‘~=-'4’ -I T'\l_":_,:'*- _.. :.J.'—J‘- "' """ - “'"" - ‘I 9* -*5*’§?‘?/.»’ ============================================= ./texts/FBIZodiac3/85.txt ======= l=EDER':&l BU_]fc_E_J§i.I__ |_.?!-‘__ gyefiwsenricau ' ' REEDRT IDEHHFICATIOH DIVISION LRTEHT FIHSERPRINT SEICFEOH T -'E___ 9-22945 J .-_.~>. L 3-, Fgrrlgigfif 51; g_49§11d5_éfl Istrve be: 2'9, ‘*3 SI L£.TCE"!' CASE Nil. m.- &5LC, San Francisco -*-A .—.‘- . :'..:: :C=\_i.-'._.-'}..<é.-.C, EXTKEKTIGN" =5 r.:.=I.c.=k':c= T'3‘]—et3"P3 11;"{;-3.-‘IE9 €*!~=«-.5!-‘M =:r-' ==a:'.rae'r:: 51*: 55.1’: E‘E."§17J3iScD EVE’-Tllrl E:'\-‘E: '"1"l'L'i..5 confirms E1.E1*.‘.? $LJp',;.-lentents jfiiutei 11_,f},éJ»"65I-, ' t P3'i=1*5 ihifi -38.58 mat i-.219.-nttcal fingerprints j or with the tangenaa-ints of the cr owing whe may an: may not he t§:|E.par'3:;qa_g nameg ;-3131; ‘:1’-EC" '5? 1: in . “ crtzia warm in _|JJ5.|LE|3! 1'1 3113'-.r 2 U ‘IElfi'3 9?; 39? Rupalmpmintahare forflmaabommn-zrpacta. 2 - sacrameutn an -\_o- Jr a '|':a|1.e¢ -_ Mb; '_='= 3 -T.FI'n'$_ REPUR1: 1'5 FUR-’5'.I'5T?5'CI f"rJ‘!I: fl'Fn".I'C.|'_.éL {£35 |;‘I.J\.'_[.jr' E - Hull-5;. 5”‘? t-MEL fi[3|l‘JUU E TELL:r~g~;I5 upfn-I: E7-:"°d ' Ii" . - .. _ 6‘-urq-\:‘€--'% '5?-iq J _ '1f;"lI:?;'I:51f 42: ‘ h _ . ' -Elna-“yin J-F‘-H__ J. .l-:I =: EoC"I'— --:1‘. Ulvm-cbar ============================================= ./texts/FBIZodiac3/86.txt ======= 3:“ I—I.'E EFL:-. 4|-€-'c'2| 1 5 ‘ ' FEEIEHAL auaaau 0? Ei‘f‘r'ESTIGAT[I:I!~.' LATENT F']'NGEFtF'Fi[NT .5.EC.'TECIN won:-c SHEET Fiecu-'de<9: 11-1-'1-E-9 9:33 -3.311. Flefvaxsnce No; 9-2296 FE-[File Nor 9-e 11.713.-"E9 SDEEEEEE-nee: Ham :1 $1.13 acts- 1.,-*1" E3 H-1 5.» Examination by: - Evidence tn:--!9c'| bk.- Fiiea wt of excl minution: 4.’? ‘(_¢9 J_f.":’E’ /1Qfi‘En<4 ;afri,!_W_Z::' fl.c}‘,__-¢L,,_ "3.5_e 9..-—» __.-.‘.u.£-C.:¢<' .:.: gnaw; ~"-at f°“5<_> —~w=Z 915' ‘Dill’ -*- Fflr 5=r -‘ ' 9 :1. , ~'= T. =-*-‘« '~:- £2 4% — JP - 3 _ _ % d~=—r~=» _5"“"F"-II"-' r-1:«.5a-.:..-_-_ _ _ Exominmicnn completed ’'7-’*'3'f-9’'f ' '57 cuictotect ”{;y 6 ;\afi[qf-;'i5"°:'|“"'; §f|1E' -I15‘ ate - r ============================================= ./texts/FBIZodiac3/87.txt ======= .1*-».. 15 Hafiehber 19$? 9 . __ Wnflz D fffifié Vnfifla EFF?’ ‘at. J. Edgar Hoover Director? F. B. I. Iashingtun, D. 0. Hana —..—....~..-.—7..—; -..-H... Dear fir. Hoover: Last night as I r- notieefl the iignifig U H;-‘,E_EI| _ -._.-._n my Huflersun Daily Bail paper _Eofi;gg_E;;lg;fs note being _/ _ ——» .. Q 1-. I spent almost a year in Germany and this is a German wora as I remember that littla German I lenrueé while there. he knflersoa paper and they Bugge be some help in finding him. sT—11{:L '3_v,_:_fi..‘}_1 mm! :5 I rzzfi-_ q=.-_— F...-—-— Thia morning I contacted t atad that E contact you, buying this might ‘£;§}{;? ============================================= ./texts/FBIZodiac3/88.txt ======= f._ . 1% November 19, 19459 ?-" ‘J0 3L Yaur Eett-213 oi Noventber l3r:l:: 1'|£.$:'- been received, The interest w:'1i»::E1 gsmnagn-ted yarn in f:a:::u'..=,J1 this i.:1{91'arJati0n to 9.2.2 is 1}}:-reciaied. Sincere 1:-' you rs, John %1- Hoover Director 1 — San Francine ~ Enclosure ?o*.9-n- I - Gal.-uocn j '.'.::m§ FEDERAL BUREAU OF IHVESHGATIDN F‘U[FA DELETED PAL‘-E |I\1'l'I'i'_'IR:1\-'|ZA":l'IIII1\I' SHEET If 1‘-’a.g'2E$:| Wifilhfilfi r:xl'tiI'fl2r' =1! Ulla lo-caxiun in the flu. Gm: or mam of tbs Fulluwiug staxunculz. when infiitamzl, explain ‘E11: d:al-ztion. H Daletiuns were made pursuant to ma emampfiaus j.n&i,e.al:.ad balcrw win: nusegregahia mateit-a1'aya5lab§= fin- :'<:lt.'.as: to ycvu. . §.m$n..§%_ D rum :1 chm:-{M U {-6365}- E1 [bl-I9-3 E1 €bIIG‘){'B'} U 'fi)|'2} a mess: M cbnrixcu D <1::uc1; pf cnmyzm :3 cm] :2: Cb}-|TTJ(E=J [1 ma} T El C|>}-['3J{FJ I3 M4} -3 (bum I'_'I 9::-ts} -3 mm ID (bani: I1 Lb:-I9} B ck;-I61 cs I:t>}I:6} I: ck:-I2?) El Infuru1.a1.'u:m 1:-a:1>ai.11~ad may to a mud party wiih me refs-ream to the saxbjeaat of}-wr mquta: or 111:: subjfifit uf 3-nu: mquest "as lisiod. in 1J1c rifle cInJj-'. D Doc!-1!'0&U.L$ efigixcane-3 W'r|'-11 another GI:wI=mm.mt ag\sut.;1'(i5s_‘.I~ ‘H1555 docm1.euv:s mus mfmed to ‘lftat a.ganc:3.r{i.e-sf: fog j'E."¢"iE.'|.F and direct response to yen. to the ralsasabiiiryr of 1J1.is infocnuaiiom fullwwixgg our can,-1IJ,tafiun, wiIJ;u the cRh,ex agn=_;;,c_-.-{i-.-.5). -nilanositlon al :1 late: date. Pages wztm mt mnsldzmd for mileagaa as they are flJ.1Fl[i.<.‘.S.13'i'E of Pages DcInta'u1 iazfurmaiiuu fi.IJ'ui£J1e=d ti:-' amzlttlnrr Govemmam agmm-'[i&s). You wlubc advisad hymn FBI as Pagvsts] wi.:}I.b.I:Jd. inasmuch as a final. Inclcasl: tlctcrminaxiun has IIW1 been mm. Yon; wjJ]t|e advised $- to the Pa,gcI:sj w'uhh.::'|d for flu: iullu-r.-Lug; :casI:I|:I(s_]: F Thc fallowiug number 1310 be usud for refczrcuxs mgsufitug ihaic p-agasr 9' ‘F9 9!".-Ir‘ 53 " E1»-|u‘e5ur¢ X XXflGKK "X DEIBIBZII Tagefsj X X N: Dupitcafiuu Fen X 2: so: this page 2: 3'iKX}€PG§JiK2{KHX}GQ{E( XXXKKK XXKXJCK KKKKKI . FBUDDI ============================================= ./texts/FBIZodiac3/93.txt ======= 3 1 - Mr. I.-"*-I==*-P-h--'5' "5-'..a-:‘::!4,-'z..-I 5'.-.--I - ~— ‘I 1 » M1-. 2 — Mr, "- 1-5 .111, ..—-.1-:._ LAJaD5I:_.{I'r§§'ar ___n.,.__ 15' FEDERAL aunuu or ENVESTIGAHBH wnsunmuu, n. c. 29525 Iéovemher 5:‘-B, 39-$9. ‘I-'a_'.; FEE, San Francisco {Q-2296} ,-..,--.+._ loam: 0: a'{"*"“"“*“"‘ EXTDFTION ‘ .. J:.:—..-. r—.';;;.-.— .t.-— -v--.—. :'R..'-u-n:-:- .-:2 '_-. _ 9-4991; 53’ CE.-15439 1*-‘J -x-—..-..;-.a~.~.»: .~.~,..-~..-=.—=- '.-3: 3'='E-I, Seen Francisco -.-.9:-2.-=m= Alrtel 11./21.359 E==uIIrIat'~u: revue-W:-2-1: C1"§'}3‘EEflal;)"BiS~ 5"<.o-:»:5k:: Enclosures (3) (1 Lalaorntory reports and @533} 1 — Sacramento (9-63] [E:I.cl<:Ici§u.re} [Laboratory report} .--:-I -*’_. ADMINISTRATIVE PAGE '-1-md-r _.,.:_ I110. Rflorfifgzarrug I34: ============================================= ./texts/FBIZodiac3/94.txt ======= ' - REFIJHT _i of the . mm ...—'|;'_ I-A307LIL1’E>.'R1' ..__.7__ FEDERJIL BUREAEI [IF |Pi\I'EST|GM'IfJI'Il Wfi.sHIflnTuN, n, c. 205:: ::‘;;j “mi” “"9" 3:2... ’:"?§§f‘§%?;* 1”“ =e- 53.13439 3; 9‘ Ex*:-o1=:m1au t’ 013: SC ~ Spwcimcflfl lccalv-9-J (25:33 Copy or handprlntaed note huaginuing “'11”!-uare‘$ no dtmhii will <30 my T11.1’.BgE"‘ anti emiing with the synabal. -"-$~." Result of exaruinauon: The cipher-text pcrtion of £2533 is not madsable using previ-ausly rsccwereci key. its brevity in-ec11.n:i=es Euruner cryptsunalgrtie e3s:a:.:.i1:sa.Lion at this time. The furnished interpretauun of "-d.-62+-v" as representing ‘-’1E~2!:I" can be ma-Ither pr5 - ti?-" -°%M[M|5TR-I54-TIVE FREE QCWHIIT» 37"‘;-W99“ LETWE '.FH'I'l 4-. -_..-..H ============================================= ./texts/FBIZodiac3/97.txt ======= £3 E_he fc~1J.n:!;vi1Lq:itI -l "' - 'AI§;yAIL" ' -l"P""?""-‘J’-I’ AI RTEL ' n:ae¢:oe§ re: cégfisailq (aTTN5 (119-ea. sac‘, SAN rm-u»rv:Isc'csL,' I:a_22g'6J (P: 5;; SUEJEGTQGDIAC EXTGRTIDH 00: Sacramento -m... .-.....,...._,.. On ll!l8f59, Enspecto San Francisco Police Depertmen - .- rintfi 0f the following individuals, :.E; .F\¢§pint5 previously submitted in this case. -3 'etErans Hospitals, both Califupnia. :4 u W- 'ihS1.~crErI¥I - __ nIv;rs1u1~I_J_’; Re San Francisco feietype tU.Bureeu, ilfifffifi. E, !!qLL=;s1:-Ed the finger- whieh are on file in he Identification Division, be compared with latent fi. Inspeetu “advised that the below listed persons are all 3efii¢uSlyuf~*~ isturbed mental getients er the Palo Alto and Henio Park fill ha nd were on weekend peas during gertinent pepicd.: Homieiee,_ ve automchileel .-,, =a L/K 3g=:4;.§LHQj!\ ’ " 9*” U {r¥‘§’_?/ _' ' _ , amen , ' _ @,. - V. 12959 '2 — . I . ‘s::~:=?§3 3 ~ ~"%‘r'*»” ’ E V U I_Q- . Ftpgmvedc ' Sent 1-.{ Per Ssuacinsl Agent j,n, Cbmge ============================================= ./texts/FBIZodiac3/98.txt ======= ============================================= ./texts/FBIZodiac3/99.txt ======= ~x=£L.;m sums or in-.fi5nGfi.noM . ‘,&'2_;_--3:5.-.-2'.-r'._.;_'. C. L; Rifflflf Jnzmmcnnfm amsron LATEQJT FINEERPFHNT EEETIDH WW __,3Efi_‘5"1 9-229: aiieczzsbex 2:, 1‘-"éi-: rs: 4135 no. 9-‘£19911-Zj‘ L.-.*rsN-1'-r.-.-use mu. A—]_EX}é2 ' W EMZ, San F1-renniam gt: XE I-‘.2; ff.’-_"'~.F\".T.'—.~"._3.‘3 -'~i:.‘i;::E. 3.1r'3*3,-‘T? Ear: Trancism E-‘re-rfiauslgz 33¢-ported lat-mt fizzgcr-prints: es-'-,6 cnc late:--=t i:_:-':*:.=.=::a‘i=.=r*= -’.‘-.’£::g22::«:-i==$ or :_=aE;.»: gs-2-§,,=.t3 tfzig C552 -1753!". icéuznnieal fin ea-prints of :‘c:?;1m:.‘..n.g iniixriflusis car r-2:-.235:-Er‘; §....~.<-§,'.'»'5.dr.:.£\,a nazaad ir: ':-e~e£::‘:;e1: MBTLED -Si 353- 21969 {Continued on rxsxrt page} 2 - '3-fli3‘l'."£t._-’-‘E_"lt-O‘ 3-.===' T.“ ¢ adh ' fiucflb -F’ "I" -- /. 'I'a~r\t!|{v~—-I.-.:>'. . - 5 gr HI}! '- "='=- -“wn —-_ ,-' .-,'1'.5'M_' Fflfiif 5 FURNISHED HER IZII.-"F.|'E.".-15 L-‘.55 n:.'.=,—'L}’ ‘- ' " Ha)-c—_ "H. H...) / John Eden: Ho u-qr, 9|-f‘Q-gtflf / '-'~=='-' ~j— I-'5-F. Ho-an ’i’ELE‘.'\'B'.€ an-I+.':| ============================================= ./texts/FBIZodiac3/100.txt ======= EM, San Franaisan Ehauewzfizvar 2, 1959 .- iateyat iztpzsve $5iCa?‘!, =s.%3_f.ch is csither e =";r1ge:-9:1:--.t £2-12:: the lover joint area -211’ a fa:-fie: £32‘ a palm print, cw:-.-1 “=1-er? «:'~t'-.ilfl'<.=1’~9 §i?:,-gflrgrintfi oi timesva £.EhC5£§'ifluel$. 5:213: rw iden- tification -effectegi. E*::.:.~=:tE;1:::.r-.3 -:15 lave: jnzafirt Eifefis oz’ the fingers a-KI pr'§_-",1-.3 05 tiyase fiaxiivictuala ,-';s:>t: -"._*:;n- teiraad zfclgrztificztion .3-*i.\'£s£nn Silas. Efllitarv 9n=.'r'~'ics r ' re 0:" am: sh. EYE <.;'x_§i;H.- -22. ‘lzfnaeae 1:-s:tit':?.cE_a.-s'}.'.s’ 1.“, rt-.*-a;::*t£ , are nu:-t 11-'_L1+'.:cte~~_' -10 ;-Gm f-jail?’ .. .,... 1 _.:.z.. . 1 _ . . 5 } 59313’ at '—-=-s:}' ant nae 1.-J.-.,..~: £<£,a;.»_= 2.:-3|.TEd. Mentificatiun rns1::I:-dz and ‘rhea,-rs-' “EE -3:-a:a:=_~c§ in this case by 5:,- 4."e_.'1em1 '.=L“:'ta=\s.$t:i,g&ti9:2 Pix-ision. P23 '3' LC in-1:1{10«§2 ============================================= ./texts/FBIZodiac3/101.txt ======= ‘*9.-vkw-1-um»:-.-I.IIn-aunt-':' -- -§-as-1+:-5. LH-—sJ:u :; ; — 1 .-u-" 1 FEDERAL BUREAU OF EN‘.-'E3TIGATIUN LATENT FENGEHPRINT SECTION WORK SHEET it‘-recorded: 1L.r'2=3+;’E~‘:7 11205 -H.|II1. Fteteienace Nu: 9'~229*5 57 FE5Il‘"§l-2 No: 9—»:.9911r -’ Received: 't_1,|"2-’-”+,."I59 bla Latent Co:-as No: i%- 10042 ’1’“‘”9-“°’ SM‘ 53:: Eraneiscu -3 Examination requested by: gsddresfiea ;1CvP5'=5='EI= SAC, Sacramento RE: ZODIAC EETCIRTIUN Elcrte of selesence communication: .5-_ir:;-3].,’ 1.}L;"19fE~9 Specimens: Named 31.1.5 eats: {SEE SECURE PAS Easel! -:>E examination: ExgmmlI:mfl ;E¥: Evidence noted. . J, :>"'*"-5-3.! .|';-5"-J“ — . ; ‘g:f’”V-(é“’Z§/‘5''i‘*°“ég‘‘“"9#§A~9— f”???-}~,4/-. a-«,.#;=f:5:E«s»-7/I -;.... ;_/fl/""‘-.'-F fig _, ._'_H(_{_?:_;/_' J , I 1?.-(A'.n'\rf:’|'|"‘f_l "V-'..fi.'_-’£nI{f._‘ vw; ' ta‘ «wt 3 ./5:11 * , é i 2 C It F éxarr-{i:1%n corn]:-lstsd E ' J" Dictuled -’ ---|;u- ‘-9 i _- _ J’ . -£1-.-t;_”£ t’!,a’5'~" -+,- _ J’ .o.- .'C-. --- -1 r a.(.,,; Time Date ============================================= ./texts/FBIZodiac3/102.txt ======= Page # 2 Bufile # 9-A9911 Reference # 9-2296 ' LC# A-lOOfl2 ============================================= ./texts/FBIZodiac3/103.txt ======= Izwca-3:: [12'3'95:' _1 300999! FEDERAL BUREAU DI‘ J]‘fl’E.‘3'I'IGA.’I‘{{}N FD-JIPA DELETED PAGE i:I\lF‘D1IMA”IIGN SEIIET -3- Pagelis} wimme «anti:-31;: ax this location tn B12. 31:. 011: 01' IJ1¢II|: ufthe Ibliflwiug 5la.tI::1m.13j_-,_ -A-hm‘: indi;-,a_:gd__ -sxpiain ‘flliai deietinu, W Deleticms Wt‘-3% mafia pun-umt In due emnmfinm isxdirzartcd below with :10 .5-rgr-=.gabe|:= mzleri.-:1 mail.-abl-9. fcu release to W11- . Szctigg 55: El {bII(1}' D IiEr}IIf7J''U'CI 1:‘ {'\fJE5J' El EWI22} III I:bJ{TJI:E} '3 firm U El:-1-E’-J ‘pf ibjcmcj E! CH-(I) _ El {b]II'C?1-ID) El Kit)-E2) _ _ El fb:II1'J‘}I'£.1 El El ‘.2 ============================================= ./texts/FBIZodiac3/106.txt ======= :9 -.1 '_-;r: r_--\.-_ _'u . 34:-.[..4| F B I F‘ Dme: L1r2e;a9 I I Trans mil the Eojtowgng Jr: J f"-"31:-c :'nk 9-Eu:-I':I(e_-rs: or :5-d|_-.l -‘—| _ AIRTEL &IRK&IL I Lu’ . (Pris-‘='=:J‘ I — — — — — — — — — — — — ~ — — ~ ~ — — ~ — — ~ _ — — — m — — _ _ — _ _ _ a _ _ _ _ _ _ fi _ _ _ _. J. _ _. _ _ __ _ _ 1 = To; DIRECTOR, FEE r9—uaa1;} % r_ fl {ATTENTIoN: znENTzEIcar1oN DIVISION) . n/ ‘ EROH: gglafigsc, SAN FRA¥C1SCG (9-229s: (23 SUBJECT: ~ zouxac EKTURTION 05: Sacramento Re Butel tn San fwancisco, dated 1LfE5IE§. L-:1" - - HGm:c;d%, Sen Traflcizcc 3- FEE pee to with latent fingerprinfis submi named ava white mala fimericans Police Department, Ffi- as» E that Lndiuiéuals, if located in identification Sivisian, be ‘C following ccmgared £11 Derscns 1ngevprints of the red in this case. DOE cfi 5,95 .2’ was I f D0 ' 1516/ DEE GEE D03 D03 fi:- ---1 Ii _. _ £935 9‘ 6/9’?//»— $9 2 ~ Sacramento 2 - San Francisco CEG:nac g W. s 7r F" ' ’ “J Appro-Jed: ‘_ 5“: M per F Special flqam in Charge ”~=-" ============================================= ./texts/FBIZodiac3/107.txt ======= ,3 "”“""“*"'°"“FEDERAL BlIREfiU OF IHVESTIQEATIOH ?.‘c*.$Ei;::g:e:1. B. C. 35537 _.:__ REPORT -'-‘N clfihg <5 Q IDEHTEFICATIDN DIVISION _‘*?9 LRTEHI FIHGERPRINTSECTIIZIH *‘“‘-_"i' “E “°- E‘--B196 Deceit:-.‘aar 4. 1-'-3* :i;;:.:‘E§§r.§.E- 9-asaiir 500 ” ‘ A-1i.i1’.'=‘§E W‘ 5.-EC. Ban .F:m*.sae Fl|§e—EFlENC'E> _!-’=_._--W1 ]_‘_-fi:;_..-_' '__ EIU. ' '3-:oI—.'-= _:_. KITMTIOL LC" 5*} wk. I-r.u.-.1 ..'.'.' -=_".'.z'_'2-"_-K1 SFECEMENE: 3'.‘9'::E&i!'L!31_?; '~.!..-‘:.£4ez1.ti!i£>"*1 I$._!.:=n1' King’-2=‘g:'.*§.r*1§ Ema hr}-C/a latent pa-es:-‘ion ifztsgurprint or“?-;zli::: girint} are-aims rat rte: this -use not imtical £L=:.g-:1-pr'ints ~ F’. -.91 -€'%,?_~'.i.mé, C33 LE<>.-‘n , 3 3, II‘-I‘;-F3.“-"at be are 92 ‘I’ named in 2-aai:-ta}. A Egmgmmprezasim, which in w aimgrfrumthelowarjolntaraaufafingernra mp:-Int, L‘, was mmfi avalilhla flngergtlnta but d -51 as 1dan_tl£1g'.-I asset: arena the flicflra and prints coaztauimd Identiflcuiiaifi files. _ Dr: 11335: nut intaernshation flu-maimed, nu ideatiflmtiun rmursis ware lacahec!-for re-mnlnm seven Ine:|51;'i.4:!I_.$.!.5 named us. reairtel. - .- - rs REPORT :5 WM':3:.=.'=.:- rm 9.FPrc.'4.: ms c-.-my ' _.. -. ' ‘Nb: uRI;i:| 2 - Sasramentu ta-sap ‘ - . a¢.1w—u— , I John Edqa U-er, Du-=u.-1+: ' '.. F:-’ . _ 1"": '3 ============================================= ./texts/FBIZodiac3/108.txt ======= -m'r' v\_-4. - .I|v¢.n_ L-.1-‘E-(Finn. ll-wfi-.63.] I _. - . "‘-"sf --f -ia- FEDERAL BUREAU OF INVESTIGATION LATENT FINEE-'HF‘|'-'.IN‘I SECTION WORK SHEET Fl-guarded: 11-98-E9 '?.‘:s{=5 1;I,.m. Flefergnyge Nu: 9-9995 FE-IF'iJ-3 Nu: 9-5.9911 {Q53 fieceive-d: ll-73-69 Tnjlc Lctenifluse N'u:fl_1U_fl¢;_L -‘trim-'-er to: SEC, San Francisco E1-:cI mirmti-0:1 requested 1:}-: .-'-\.a:!c_1L-lessee __._:g C-Inga-'1o:=Q,‘ 3-‘EC, S$C'.|.'$T|'|Er|.tCI [/'2'?‘ RE= Zenrac E.:c1:oRTIc-N 513%‘ --;-:1. [hie of-.'=,-Fare-:1<:e mu-.I:n=.I.n1<:atz'o:u: fi~j_;-tel 11-05 .59 Specimens: Named _ . / Lil}; J"'§"_l 13313 --1“-_J:i;o.--_--’. ‘wit grrc. = as’; aw ~ =>=~~L-K .- 7.-I , D3 FL-esult of excminatiarg: - ‘ - Exc||T|_i'|j&{jQ|j by; — I I _- Evidence acted by: id 75,. :2. IE, If/95 3“@l|!n§.w'-' ' W wiréroé »~‘-,r’f- . ; 5,. _ .. 51 (W~.2’=%~:«w *=*=,a=~t‘5-.«9JJ~'~}‘1"“‘:/"“’”"'“fi"’/E/7/;’”‘E': ,,:'.g ,M.,; ,?/?é;z§:/. £~«;.a., ?cg’;.,.:,.,7...J.ze-mm ,__Hfi,-”,,_r,.;.,,., MJ-' .r«~—Z5._Qf Exumiuutim co.-nplmued 1; _ D§¢[-'.'|:|;-:-:I 93% 3,15"-F ' Tune -2152 at ============================================= ./texts/FBIZodiac4/1.txt ======= Freedom of Information and Privacy A C15‘ 3:: Eject: ZODIAC KILLER File Number: 9-H 0-4991 1 SECTION A Federal Bureau ofln vestigation ============================================= ./texts/FBIZodiac4/2.txt ======= t‘:T':'?|5W'E'-'_ .. __ ""'-.'- ============================================= ./texts/FBIZodiac4/3.txt ======= -i - ram: it-1::-.5-sea-54: ' ' pa; I'- .. . 'L-‘fa? __ - -- a_:':.__. . .F -E‘ 1 " " JCfvc;:le: ' whit: male Angniéans, suasnittéd in 1:1-xi‘ ~ .1 e. _'d ' t, :5 . . = . . . I d.é’%.iE_b.iE.¢.6umE *2-"=~es':'a1.: ,. ~ ;Eabrahgntn_(9—5B1 2'; Bah Francisco 3' flEG,I'_Et‘"|.r‘ .' (.5_»"-"-':- ' - "Special Agant in I3]1.m-g:_- — § _ ============================================= ./texts/FBIZodiac4/4.txt ======= r - . - -. '_-'-ins-géct-or; s‘ 'f;>11c:1-a:‘:J:g:'~1:v_-.e:_F_nts aZ_|.sc:__:= __-__._._..u.J...,..,.,..=..-—;w_.....'-..-—..—- ============================================= ./texts/FBIZodiac4/5.txt ======= ;‘"'53’EED"{.:l.- menu or iiw ;I1s§1;o_y ‘“ wmahinqtonz -1:{.__r:'.__=_2I;g:-31 ~ 3:503: Lf » -' Ears rfiivéar-5 1-'t.r_R.-.'r.rs):'a'i:~ Fifi rJ'é'}¢'ICI.iL'-ESE "am? ' _LE_‘f¥'E UNHE] ============================================= ./texts/FBIZodiac4/6.txt ======= 1-ill-CR-u-1'. L:--3-==$J ”T'-‘- - . _....' -__v-'\-..-:' 3.. ~».-?‘. FEDERAL BEJFIE.-UJ IZIF INVESTIGATION LATENT FINGEEFFINT SECTEON WCIRK SHEET ' Flee-was-dr 1.2»-1--E-'9 111513 a.n. Ha:-mm-.7: N-as ‘ 9-2296 - - 1 : x - _ "'1 Received: 12-1-59 331-1 _ 2:2-:1 Igor}: No'?\:-fiEfl he-'="-2r1<== s»=c,‘sa.:1“rrana1m'i. Examination requested J31.-:-K .fi.dd|.'e'5se.-E 33°F‘-" *9-1‘?-'5a*aC.I‘ Ba-r:raLInm1fl:'r\ (5'- 63] L _ +4-:_'. " $5‘ zonulnz‘-, _ " “ EXICFRTIDH ‘;.fl_;:Ite_ r:.f.r2_:’eI:Q:Ice communiodtion: 1‘ A.j_-|_-tell -“"]_]—2fl—fi.9 ‘ _fl"“““'?"5= Named Susi cts: ' ‘- Y 5 "41:. Rm. "'F'|_I aka. ETC- Beaull nf EB3 .,'$'§-' ... $9‘ _' ION . .. _,,- _ :.:-_..-= _:. :i.'i'-JE=_*'1'1'_=¢ as ._> g. _“§7~ ============================================= ./texts/FBIZodiac4/14.txt ======= ============================================= ./texts/FBIZodiac4/15.txt ======= r—-as -!E|.e:'- L1-M91 ’ ‘ :7’: - -2? was FEEEHAL BUREAU CH? §NVE$TIG$T3‘3N LATE; FINGSHPHINT SECTION WORK EHE ET Fleeocdgd*.11.I"2|5r'|5g' E-:¢'l_U arm: Hefeiflfltte No: 9'22?‘-E‘ FE-I File Nu: 949911 If;-,~ FL'E*|3B2i'-"El'd.3-!-1.|'r2E‘.IFE9 131-3 _ Latent Case No: A-1C|'3-‘5}2 :' -“flaw?” 10:51-16, San 1-7:1‘-anczisvzu ' - ' ' ' '~ - Exuminalian re.-qLL$sl=_v-d by: Addres se--Q '3“5’5" M: 33¢, Sacramento 9 H2?) FIE: W‘ ' —'. - ' "- ~- "-a\_r ZCID IA-{I EXTDRT I OH Eire of I.’-E'i-El.’-E-E1.CE zammunicutiunz §Lj'_1_-tel , ]_]_f g4,n‘59 r:'L;11.e:-113: ..~. _.'_'_,_ flamed 51.15 acts: 17'!‘-’ (SEE - Flesull of $xn1rnlm:rr.'um: » -- Exumimtion by: E H./éc’ Evidence naigd, by: .:'?¢«¢:+- J/fr, _, : F 1~ K-'fu-d—r?"‘-“~61/--ff" A4-— 2&1:-— . 1540 P45 :5 - [[119 &«o=-«.'~s- / Aw _{r-r-:5»,-'7:Ldf " I I 5 '5] /4“ M‘. p£J'9L.]JF‘”; ?._;,. t 3“. {;,,£.._'§'5;"7?6 I-' I = Examination -=«=-rapist-ad _Q -'i’‘-'‘ 1% J-_7',4‘i.£L Dlctuted '9 3 F ' - T <1 3- are Wt ""'.....q_..—.:........._..._..—.—._._..._._.._..._..._._— ____. _ _ _ _ . _._J wr ============================================= ./texts/FBIZodiac4/16.txt ======= .K¢§ =w Faga # 2 B "la # 9-49311 Re rence £3‘ '9—229'5' Lei A-1C-(M2 ' ' _ , - -. -' has I _ . .- * /2;-a-it . ._-.;;__°_ . s=-‘,é;»Zf~,« ':.-. _;;;¢1-J_v3£:h;3?1as5.' . . - ============================================= ./texts/FBIZodiac4/22.txt ======= EVIDENCE FEDEIIAI. HUIIEALI Dl INVESTIGATION WASIIIHGTOH. D. C ============================================= ./texts/FBIZodiac4/23.txt ======= C|.PCh-Bi?‘ {E36-PEI FEDERAL lsU'.E:]:.aU OF l1‘WES'I'IGA'I'IC|N DELETED man ]1'i'.F-CIltl~L§n'I'II2r2vT SHE’? FOIPA [3 L‘-‘ag<:(s} Withhflfl 4=cI.Iir'3l:r 31: ibis lucaxiun in flu: filc. One 05 mm +:If1I1c folluwing 5ta1.B:I11Bt:II.-5, -.vtu:.rc ]'.I1di@‘I:Bd__ Exphjil |‘.hL!. deletion. gt Damion: warn made 1:rI.:r5I.1a|:I; to we exemptions helatw wllhna aagagable mate.-rial 5.1-3113;-;]u_-, for :I:lI:.a:::=: DU :r*:rI.I. u {um} i3 {him El -':b){3) U EPJE4) :1 E'0}[5} D I:‘c~>t6} U cbrmw I: It-}l'UCBI| N «:1:-mace} II macaw: U WJUJEEJ El €bZJC?3IEF} U Chm?) U chm- _ U EIi5{5J U EH2] El 1.'k)-{1) 13 {kI|'C13I El 0531333 U fkI|(4} U -U5I"C5}I U {kilfé} U 'Ck}i'-'-‘} El mrarmetmn ptcrtainead bulge in a Lhi.11:1 '|'.IB.l‘l3' wtflt no reference to the subject of3.~o'IJ.traqut;1 01 the subjcct ofjruur reaq-mat is listed in flue title cmJ;..-_ D D¢cume1JLs origiraanad with summer Gammmut agents-{i¢s]. 113:5: dmunmxa were nsfmad to 11131 3.51.‘-:c:J-'lIJ'&S] fa: res-ietw and djmci wagons: to you. ‘Fag-as I;-:1n1ai:L Lnrarmmicln nunishnaul bysmmgr Gmwammean agemyfiasj. ‘fen wi.]11}e advised byihu; E31 3; 1:: Lime releasabiliry cu1'1:n.is i.111'<:rrmam:I.tL IcI1ln:r'.'-ing nu: -:c«us'L:1'La1:in-11 W119! the cum a.-geuv:-'_-.r{'L-as). disposition. ax a law data 3 115:: fotlcrwlng aumhta L: to he used far refia-mun: KEEIILKK }§K3{I-U1'_T=€ IFage{3:I 9.-'i:z1E1e1<1 T5? the I|'E|]l[!I'&'i.11|.g tbE|.9.'!-!l'l{:’,}: -6'» _(g—22aa) (:9) u5iIEcT:. 31:15:11-=Lc I M ERTURTICIN _ '- ; ten: $P,¢P~At-§E§\EI£J} _ $ ._Ea_§an Frfinei5co.Eirt&; to fiufigfiu datéa1i2f3}§9. _- ~ L.=_!;m:_.m;' L Police Departma , eques Q ' t thé’f1ngérpr§nE; Q; thg ' ,: -fc:1_1gwi:_1 _;Ln;1i_uidu.'a1s .a11EEg,‘§g1: - :mefithI3d15ordef7'he c$mparedTw1th’lEtent fingerp; aubmitted in ? as case: n . u .5" I. 3:» _ :-5 "_ .. 110,22-_ 4:tE-‘BI-R'II-Iw 3.=.»' - 2 -.Sacramanto {Q-E85 2 - San Francisco GEG:m&l - an ============================================= ./texts/FBIZodiac4/27.txt ======= aumuj or 1:, _'.i’m33.'I.J':I.<;’tn:Iz_I., D. C. 2|Zl53'-" R§EDRT- ' .~ - '£ - urrc,mop.r 'igg1It_;Az_:on f . - ".fi"E\9 REPORT 13 FE,I'R.-‘1'J'3 1'1.-E-U flflfi OFF-"5-NIL ESE U!'I'I. _ sIut|:|'.':Icofl1-e -'5-"l';'i=5Es.i:-:|'r: I. " "1 5" " '-. - 0 -' - '- ' - 1' .'-'- __u.,_.. ....—..-._.j __.—T%H1fl%wj._._..__Wm “wnfigE1_ ============================================= ./texts/FBIZodiac4/28.txt ======= . 3 rd_,,__\_ L—3s |IF|~='u'- IL—;—&€|: _ _ P _‘ . __5_¢ <_v_,,. - -‘T-3* r’--.1 — - FED'EH:*5u§_. BUFIE-‘EU CIF IN".I'ESTI'GAT'[CIN LATENT FENGEHPRJNT $'E'CTiCIN WORK SHEET‘ 9_2396 Flecotded: 12-3-69 'Q:DD a.m. fir;-ferancg No: -- - - F'BfPi]e No: 949911‘ ' '- " ' R.;ac*eivv3<£: 12-3-£39 amb ~ Latent Case No: 191-10042 fiatswerto: SAC. flan Francisco Examination mquswtqd by: Afidreggee _'C-am-' to:_;l' SM}, Sacrsmentu (9-63) , _ 4-C:_,'_ _ _ _ __ '- RE: zoflfnc EKTDRTION Flgsult of examination: Examination by: If Evident-9 noted 1; iv?’ “ *3 -3 xsl If my “.6,/5,: - ' ,;;5,,,,g m_;,,_,)f,m_ fi,¢,.,,z:,/2:42;. -AM .r‘1"""‘-'7‘, 5*’ ' fifé I _ ,1i.a~»&-1;; F FTC-— Lflfgirdflbzz... ,6 Egg - J; 3 '~.—*:: I.-'__j_.v .» J 5*‘/W4 "‘?*M?$;/ mam «: /w-=~=- '.rW*=«—'=~*w’."'; at-*1~“ Q . r’ , Examinution Completed 4 Dictcttgd 0 "5; Time ute JJCI V ============================================= ./texts/FBIZodiac4/29.txt ======= "D-35_[H-_-u-__ 5-21.5.4] . Zbfllfic _ EX'I'|2JR’I’_IUN .' CID: Eacpmaénta 1='._e sac:-'m:e=n_1:.£»'-iatter--to _A1cJ.a’nta am W’ ",on :.2_.r.1 as , 1: fiéi:a'11',- s&1’1..rpa:_{a'isc'o _1=o epa , 1:h'a"l:_-_t'he-‘fingerplfints -o.'E’._‘t_hE-.- below 3.‘:'L's‘te’-‘:1 ' gr {£1} tilg .iI;' the Identificat ‘r. 11:‘. §:i.':':n ’”camparé'r:f a't«e1_1't.""fi_1:Ige:r~'p"1:=_'.:1'1:'a_ 311- via 3 case: . _ - _ i~.$£acr~amen'L'u' (9:53: __E'1~an::iaa¢ ' -.a-s:\«-.x- - 'sériL ============================================= ./texts/FBIZodiac4/30.txt ======= U PCA-241 E l‘1-3 JJEJI FEDE|U|nL BUREAU OF IN'V'.ES'.fIGA’I'I{)N ‘flELE'I'ED PAGE HDN E.".l' FOIPJSL Pageflrs) m'fl1IraId enxirelyr at tho‘; locmou iufllc 53:. Gun: or -mm aha». fiuuowiugsuamnumx, where H1113-i-it this dalmiun. jfl Dvslcliuus was made p:u:sus.u.: tn fire exanmliom budicamd in-:1-aw withnu swmhm Iflaltriai ava.i1:a]:I1c.fI:uI_' J:I:J-:35: tcl you. %.'JE_%§3.. 1:‘ |.T=}E1} U {bI|\'£3fI El 033(3) El 111}[€' G QJHE‘ III l'.'b3C€3 I3 {tr}-£7JE_:‘fl El i.’b]I31'}|.'B'} H Cb:-fiJ segeyhlc .n3=at¢I:i.a1 available for mlcasc to )‘E||3. £ n rm-{tn E: nzwmw I3 {data} El {EH33 U (E-}[7J{33 E‘ '|'.i}[i-‘.'|' E‘ {hm-J M |3=-HUKC} U fl=I'E11 U EbJ{'TJI1DJ I3 Germ El Eb”J'["3'JCEJ E‘ NR3) U EbJ{'UlCFJ I3 {lent-11 CI -:‘bZ||:-4:! El |ih)'[i?J E‘ 'U€)(5II III -rt-JESJ I3 mm C4 mm III lit-Jt-53 E1 mm B Iuitlrmaxion penainad cmlsrtu a third party with no rem-nun: no the 3L'tje:: of your request El!’ tin: suhjazt cIf1.ro1LI request is listai Ln flap tjfle uni}: El D9:J.1.rne-1115 ndginabad ‘¢'Fi.|fifi1I|.0‘|tl.EI Guvaanmxmi a,gm1x:ffiea}_ These documenxa W-are D6f6:l'l.'\E=d to fhat agsncgrfizaj (Elf IE1-"5EW I-L|'lI1 -U'lPB.'i[ !"€.'flJCCl1.’sE ID 3'E|li. Pagas BOIZIL-55.0. 2iJ1fDl'JJJ.3I5E"|Z| furnished E}? Hummer Gusreurnmant £mEJ*L’JI=3}- You ‘-i'i|.1t:-E El.£]1:'i5$E I5}-'|:bE FBI as to the mimsability «If this i:I.fi:I1'n1a.t'u:In I'I:I[lcr?«I'iI1g12I1.I.1' m1J.EIJJta.fic|:1 wilh its EIIJIIE-‘I agEl1I.'=_'.r{'lw'-B). Pegmjs} 'W'.iLt|]:lB]fl inasnmch as a final Icleast: d.El‘DEll'.l'|2l.i.D'E.£i.{I.E| has not be-an made. You will; be advjsed as to flu: dL7-p-oszitiun at a. Lam: dam. Pages were JJIJE unnsifierett In! release as may axe clupli-::.am'e IJI Psgefis-} 'A'iL]I|]Ilfl_|i fin the Eu|:|.vUwi.u.gre;5unI'__sj: JH The fc>11aw-imgnumber 1'3 bubs used for lBfB‘.T£DCB :'-zgs.1'di.13g (bass pagss: ‘L ‘ffi.r"f- '7!’ 11;“. KX XXXXXXX X Dcicmd 'F'agcIfsj X X No Eilupllcaxinn F0: )5". X Eur this Flag: 1. KX KXfiX XJLXXXK HKKKKK HKPEKKK . ?B|£I'DDJ' ============================================= ./texts/FBIZodiac4/35.txt ======= ============================================= ./texts/FBIZodiac4/36.txt ======= . '-éh-B ' Ide:_1t'ifi_cat§.c.;1'1- T.'.i..U'-.'i.“::1-;:|1'I is lrefgsie-étt;-1‘ _ 1:1-_1 f:.nga_r~p:~;_:1_.ts-_'of_-_a1L._indiviflgals set fr-fi.nt15§];u:~:_~ex1rii_Eu1_s.;[,}!r_ $_1.J.‘ICJI|1II_i-_‘}.f_“!.'_'BI:'1 in; 'this_% atg ============================================= ./texts/FBIZodiac4/37.txt ======= "§=:H%9:%~%I~<%% _ _' ¥IcifiJ,fi"-‘L’:-‘i’ _.: G-" 3; ma‘-=é _ _ _ THEE E3905? #5‘ -F_£r'F.‘-'\"-'5.-':'.».‘7J3' FOR‘ OFFICIAL {I33 I‘- . - ' - . . .=_ , _ 9-=wr' _. .. sum-n:-.m... 5*‘ ============================================= ./texts/FBIZodiac4/38.txt ======= ============================================= ./texts/FBIZodiac4/39.txt ======= L..’a,5 [Q-5-\.I..! L—6 -I-3] ' ._ .,: -'._- ‘KW? ".1-e...r" FEDERAL. EIUEE-EU <3? HWEETIGAII-W LATENT FINGERPEEN? SECTION WORK SHEET REICCIFEIBE3: 3.113. Reference. Na: - _ F13: Fiig No: 9-£9911 ‘git _ Fl-f='-zlzivsd: 12!'5-,u'?'Ef9 Z111 _ Latent CHE? N0! A—1Up"-52 " ' Answer to: SAC, San_F-rancisco" ' " '- - _ ' Exctlninutlun Iequasied by: Addteggag ’ $;.\__C:."C>F>"'t<:_I3;_- SAG, Sacgamentd {?—.:.fJ ; _ _ -* _ «L; -" . RE? . lzi.‘-ID-I.-‘stif- EETURTIDH _ __,_Q::t-5_:II rsiarsllac-3 snmmuni-zcthion: H1!-‘EE1. 124'r3J"59 3:-_’éc‘1'rrser.s: Se-2 attachad.-'-list of Suspects: C-_.,E m/g C ' 5?-c. Hsauli of examination: Exnmimiion bf; — ' _ Evidence mzlied by. J11“ ,«.-J-M.,«£1~a:,.:C» -44--?( c.o+«3fiL--—='.-/_1,=c}_,..;-i 3,» /J,/.¢.{;.,,_ WL - - .- . 0: Escwnznauon -ocnmpleted & Dlctuted i ' LE" 4,} urn-z ozts _ te ' :31 t j -v-v-v—v--- ============================================= ./texts/FBIZodiac4/40.txt ======= upc_.-..qr.n:11-3-96;: 3"?7§?'§?‘-7C9'i FEDERAL B-1§RE&U OF DITESFIGATIDN FDIE11 I‘-‘El.-E-TEIJ WAGE JJ."i'E'CfllJ!‘L.~'-;"1"I|31'E El" 53* Pageljg withhold um:iIcE]r ax flu": ].oGaticI|:L in the file. On: or mark CITT-be f01JI5|WiJJ~.Ex'—TE‘|flD1W-T3: ‘-When: i.miiI:a.!e.d, explain Unis dclctbcm. fl Duip:;i,:-11,5 were made: pmsuant to the cxcrjnpriuus infilcamcl bdcrw w'L1i1 no acgprtyhia mactmial B.='aiL31:Il¢ I'uI.' nilmfit lc }'\CIK‘.I.. § Se.i:tEm:;553a cu a:-nu:- I3 <=:}mcA:- :3 {ants} Er ::Ir:u:z:- 1:: mmuazu :3 (13-62) :1 chats} fit GLHTJKCJ :: mm)- _ 1:! cmmmzu :2 mar} _ El cI:H?Jr.:EJ 5! WEE} _ U rim:-rn-:15: CI alum U :::-:-:«-:- U (31:43) I3 GQI5} U chm :1 (W911 U -scam} El I:hjI:6;- El WIT} El Iflfflrmatluu per!.ai.11.ed fi‘Jll)' tn a third paw with no Icfuxmue 1:: I119 -91-L1}j9€I Df‘r'D‘lJl' 1.'9<11-I-‘:51 ‘M 1-‘Ll-3 SWJW 95.1-"3‘-1-F request is Eistod in UJJ: tiflr: :IJJ3]r. El Dcswme-mas n:ur1'_g'LJ'L:at-ad 1.r,"Lfl1.an<:rrJ1er Gmreanmeul agancflies}. These do-I:u.u:m:Ir.s wr.'s::= rcierrcfl Lu that a,,g}:'.11.~’.',';w[ics.JI fa: rwiew and direct Iaspunava to you. Peg-as auutain i.nEurm.a1.itm fi1:ruish.e=:l by mama: Gwsmmmi agm=y'tim}- Y-an will he aévis-ad by the FBI as an UL: role:-sabilttr n:uf1.11.1'.a informalzi-an mllfiwlngw: €‘-0.IJ:'l:T|-|l131.i.'i}¢1 wiah the nihm agBu3‘;'Cl'3€-}- J,"-"aga(a.} wiflnhsld inasmuch as 51 Fatal release d u has 1101 'b-arm aua.r1I:. Yo-.1 will bx: advised as In % dbapu-a='L1:i.n:a1 HI a laxecr dam. P935 mm I:Lul UmJ.aJ'dI:1'r:(1 for tfilfif-E -as U!-3}’ BIB duplioative cf L’-mafia) winbhsld for the fa-11cI'.=v'iflg I9-asc-nis}: fl 1'13,-3 f1}lLm.!-ing nuzrnh-yr is to be used far I-aiereiwe regarding mm pasts-: 9* ‘r’°F9»'!+ ?f .6‘-u_s,:_.-. 3' '3' X3Ds'flI2§II7‘C?'I55.?C’i3‘EP1» -.r :'EJ".! Q1555 ad _ "f -'_|:hE-.-.f_ol Em __ -. .¢ =1:-"'1?°-"Dar-¥*=+=*'e¢&st.'-fffili-G . .,- $‘Y'*§‘I|,_I:I;ie’.’-9f'.' :—:_a:'r ,rr1aa_:;c;1'qj:4a‘*3«§_ue:s;rs13'ai" e'ie.;7£=':?:iT:i _ _ . -c=z__1:'in*az«1»:e:1_;:_.2 _:t.11_.«'s9._‘a-x:_': _£<-an _Ei~e=.r.rc 512;-__ em'::Lu_qi-.n -.fr~§:i:i1"A3a'1n.f-cl-;:'g;y' B-::o}':‘1\TsJJJJ.J:-er‘ El eaptics-ne:j_]§Iaj,r fo-I‘-_._I.-'eO.'._.,/,.____:-_~ _._:_._,_. ~_: __. . I __ i|Ii:1-'_l-3--D.}:.'\:|‘iE.5. _ n_ ;_T.0nI'.|.‘Bl1-_E'I‘_I.'E1D_'_S§|EBE$' 1:ca.,Eu;~e_e_:u 3"“ _.’ _ -9» :€.> ='--'_*-._-'*.\-.=-—_'='.‘-3.-’.'-' x.-7;-I ============================================= ./texts/FBIZodiac4/42.txt ======= & _ . _9:';.¥'*2°=.;= «T-:r».e:~;:ajg;tra°°g:¥fa‘f;t .. ;%‘%g%**’ '- _. '-2.’£_ ' ._x_ ============================================= ./texts/FBIZodiac4/43.txt ======= :;4_u5'T_;|rpe_ in pic-|l'fll-|!__Kl W ::na'.g_.' 4' "sin-e.'.e'. . _ 2'_-_'--star-a:n1:'.tu ‘£1 . . ._ 2'_'-_ Sui, fvlnciscu §i_t.-n_e;11n'-- .4-5-In ‘F4 §_ "K. 1| Special Agent in Chaxgg j-'—?"_"""""""'-T‘ - . ._ -_-"”'-”‘-"“-"“"-_"'“-"-' """" =P~ .'_ ============================================= ./texts/FBIZodiac4/44.txt ======= Ell"-BSA-‘GD Cl‘2-i-945] FEDERAL E-T.|Il.EAU OF ]]'l"iv".l?S1"Il3J|.'l"]l2lI~i! FDIP.-5. I|EI.E1"ElI| PAGE WON SHEET :3 Pagefia} w:'|fl1beId I,'.q1fil.'\e|j-' £1: 1'.'b_'i,$]-;)mil’;i¢:|J, in Lha fije. Clue our mare efthe £u1J:J9«Ii:IJ,g-I-1=9.|JI!IJ3I£IIls, 'sv‘!1I:J:I= -explain H315 deletion. gfl D1‘,-.1m_'i|:|t3I,5 were made pmeuant no the exemptlm indiwaed bd-Uw Millalfl S®'B§1J1B Dlaltrlal ¢t\"+1.'LLi-lble for relmse ID you. D {bjlilfi U {bI|'15'»]I '3 {bJ'C1‘3 El {'b'.I{4J El Etflifl El |It|]{5] U WJFH5} U {13'}"5'}{BC| pr rbnrem cu rulmtm '3 fbJ'5"}'[E] _~ "I3 tmmrn 53 511(5) 1:1 (5:49) Mali 5521 |:||:|E|UE|E|D|"_'| Ci {UJ{'J_.J {El-1?3| {k}{ U |.'KJ'|32J CW3} |.'3¢}|I4} fJ€)L57 '3=]"I‘5} (kl?) El T.11f:In:I1:a1:iI:.e1 pertailzlexi only no a um‘ eetty with no reference he the subiwet of :.-euur request or Use -5-utfiwt bf-seer 'lID{]1JC5t is Listed Le U32 till-8 D1313-'- |:| Du-cum,-::u'_s orj'$jE|_a'b$d w1=.na-11¢-1311:: II3~:wc1-nmcm ageanycicsj. Ttume due1u:n.e:e1z. were referred to mat ag=u.c',-rfiae} fcu-1_-e-.n-is-.grs.1'u14§i.1'e::t seep-:m.5.e tuyeu. to 111-: re]m§eJ:I'Llir_I.r :-H111‘: j.TIi'1:-L11:rati.En fe]lewiJ1.gveI.I: uuusulaatimx wiJ'J:u the other ageucflies). nil.-spasiticxt at 2; [am date. 2Page{s;I =-iahheld for the follawin.-g raasuntsjlz Pages were not eensideeefl for release as they are fluplieative of ;Pag& oonmin jJ1,[‘u;uI::|1:|,a.Ein:In f|.1.l'I;I,LE-l1.IZ=d. bjrammhvzg Guw-rnmem ageIu2:;r{':m}. TIJIJ S-'-I1'.1|b€ 3.6.1-'i5£Iib3f|i1B F31 as §PBg£($] wiI'JJ,ue]:1 inasmuch as a renal release de{er1JJJ'.1J.sJ1'e:1 has not 13-ace made. ‘fee will be advised as In *1: H The 'I_'u:uI,|_d:r'\.1.I?:Ig:I1,1,u11I;|EJ: is [D be used fur refinance regarding I'.1:II:-it pw: KXXXKX KKKXXX XKKKJLX -1,g__L+'e¢.rLr7f (3011: I H‘ 2- flQm K Deleted 'Page[s] I X No Duplication Fez K 3; for this page X }QQ§?i.'{}§}G§}§}CKPC§GQCX FBUDUJ ============================================= ./texts/FBIZodiac4/45.txt ======= QAL annual: or IN‘ £.]'IGAT|DN ., '.|.‘I‘a$h§:Ie;tt<:I:I. D. '53. "1553: ____\_ |DE'|"lIflFi'C;'iI";'."I:'|LE_l1it.iL:E '.__'iJl'{|}l‘$l't'J'i"i"' L »!_.__T Er; F__i_hl G E__F.__E__a’g NT -5 E'_c Tamra; < us hear J5‘ $';.r;z.'I.'r.r:-tJr.r.Iz.::u bah .r.:u5Hc.*.u. ass‘ on? ' ============================================= ./texts/FBIZodiac4/46.txt ======= ============================================= ./texts/FBIZodiac4/47.txt ======= '- »' ' ‘L--3|! Ffiév. SI-5-391 “Q? I‘. FEDERAL BUREAU OF’ INUESTIGATION Lil. TENT FINGER PFIINT SECT ION ':!"~Z}FI}C SHE ET Hr:¢<>i'dc-d! 12-11-69 2 :45 p. m . Reference N-=-: 95-2295 3 . FBI File N0: Q—~4199ll '“ '7 f_ + ' Her.-ea-53:5: 12-11569 1-gm _ Late-nl Case No: a-~1OI:}¢1,,'2 Auawcrtol SAC, San Francisco Exumirwztiun requesiad 12'.-‘I A.dq§1-35533 com’ 19.: 1; Ee5I:___. Sacramerntiz |_"g_.5, . . 1.1:; HE: z0n1£é' ' EXTORTION _ __-ECl.tE:_‘J,E rejggenca» communication: :1-tel '33.._9.'.;.5Q i 9‘”mme = '7-Pf: H5 See attached may Lfzi saga 3.1/,; jg-J bqb ‘ Co f,.,§'._;,....gF gS',z..; M ‘ ' - fies uJi ofiaxqminutiunt Examination by: «saw giwif M ,%Zf}‘:°;::?'AM¢.x/1. /1w~—-k-mu-(;,,mL~m /~d~_..£u,.Z ,mqAFfljfl?mwfdR$Q¢/$4; ' ___W._’: r.1,v’I3 ,-"re 3‘ .. 4:15 ,"Ja:=n:’/ _ “' . Examination completed " J '3 4 Dictctted -'7 J ; ime Ell ts- -'—"-‘-v-v-v-“:'“"-"“‘-'-vv:——-—— ---- -—-v—~— -—.o-mm-w-u--.-.-v-u—u-u— -c-jw-w'w-at ----- -- --w-----n:- ============================================= ./texts/FBIZodiac4/48.txt ======= curt.-.y.,.au (125.95; ' 3 FEDERAL BUREALU OF ]N1r"E.SI'IGA.'I'I£E*I' FOIZFA DEl..EI'EIJ l"!t'(E HON SHEET -I2‘ Pagcfis} wiunhcld I:m.1':\'J,:r at Lbis Jnfitiun in the file. Cine ufmmt of the fullms-'i.ug SLa.EBCI12I,E:],L$,_ flame indir_-3:51, ax-plain this deletion. ,3 Deletions were madua punsuant to fix exelnptiusas ialdilzatcd b-claw wtaunu xgregahie maltrial available Fa: rel-223,3 to you. g Sa:tion- 552:: El {ti}-{ll Cl ct-:-£710-3 :21 Hits}- E! (bit?) El IC|r}|37J03JI '3 ciilllifl} El (bits) pt’ EbH'?J£-3) III {km} El Eb‘.I:T,IU5"I' El EEIEE} U rbnmrfi} E! |3t2I[3} U n:-:nmtPJ Er (mt-1} U M4} III fl:-JCS} El ck:-£5) El It-3-[S I:I MED} El [I13-{EU Cl t'tfl{~‘D El -fk;|("U El iflfionuasiun 1:I<:Ita.i:I:w-I11 only to a U:Ii.I:\d party with no miemncaz. to TJ;|.e subject of3.ro1.1-,r request or me subject of }-nu; mequasz Ls lisnbd in 1.11-: title only. El D061-IJ'r1.E:I1W Dflgi-ilfilfld Will} 5-Elflthflf Gmmmeut sg=u:_-mic-5}. ’l'.lJ.¢:—'aI: duwmuus ware Iefenqd to IJ:n11 agent;-6:3} in: review and d:il'-E-I1 raspuuse. to you. Fags contain. Lufumutimx filmishod. by malts: Govemmzux agencyfiias}. You wE1J_1;-e aduixaa by um FBI as to Thai xeleasahillrhr of this hafnxmatleu 1’<>]§u-A-Jaaguur -:<:unsL:11>aL'u}11 with 111.: can: a.g;an:.“.'_'r[ies‘,+. P359-(=2-h wifl:I.|:Ic]d inasmuch as .1 fiaml reilmse eictcrminaxiuu has not been made. ‘rem 1.;-U_1 13:3 agiyiscd a; to am Elwuslaicn at :1 later dame. Ffigcs were: not mnsidrred for release as may an: dupllcafiwa sf Pagcta} witb.|:I=Jr1 £03: |JU.: §b]]I:rwi11g re-asGn.(a}: fl T|:II= fi:r]]uw'.in.g number is 1a bi: uscd for Iciwmm I4:ga.TdL|2g dzuaae pagas: Fe’ HWIHQF: J‘:-('7 X EEfiKXXX K 'Dc[I:1ucl'Pi1g|3[5) X X No tlupiinafiun Fe: 3; X for alfili-5 Wig: X XEUEHHJECKKXIEEDLKX XX.‘-(I2i}{ DQQXKECX DLXXXIX . 1-'E:r.I1;Iur ============================================= ./texts/FBIZodiac4/49.txt ======= u; :2 I-.-I9:-n.r::.z or co-is»? . _ .2 - v;a.11ej.as,}-’:'¢:;a'1i,sa:':-nia .-.-7v'1':.':'1-i mmmont-.é3"*_* '“ ~-.'“ ‘ on . pk; tv£g'igj5_i1_¥s:t3ui-an ‘=.!’é’%{¢I5!§‘ 3%. _. .., _ -_ -~---- ---um-u-n-..-~—u--_u: I _ _ -_pw.._..ar.._..T.__~m:a,_=¢.¢1g=d=.5_,=,t,,;_,q_fl._._}.._ ============================================= ./texts/FBIZodiac4/50.txt ======= c-$mp1ex1im_ _ ,: 'E11i1c1-_ ' . FBI - HEP He§_:m.:g,r;l55.. _ . Shawn. . I nti 13!-f1'S1.1ver.'i3u"_#_fl‘-oufi.'t3"‘ SU- ============================================= ./texts/FBIZodiac4/51.txt ======= Wwshinqton, E}. C‘ 20537 4-“.__ J ---g""i'L"?!"1. ' L 7 Insutlrlcnrt ws1o:~i _:Ef_E rgi _Tj "F_-'f'i~4_?ar"E'rr _F-"r:-1'r4_1*_-532 «::'':_-I "n N i°"”j%="ra gill BI.lREA'lI- or IR gsrlsnuou nus '_ _\r~CIuH_FIL5 Nd. fa; Pu,‘ 19. . ============================================= ./texts/FBIZodiac4/52.txt ======= la‘!-E |H-&'u- El‘?-Bil -._-.—- .__w_.- . ‘_ - . _-“fin FEUERJKL BUHETJKU OF INVESTIGRTION I -..- _ L9-TENT FINGEHPRENT SEISTHEIN WORK SHEET __ Hecmdad‘ 12/'10./'69 3 :45 3-:1J1 fleferencs N03-#5? 9' I ' FBI F'i§9 NU: 9-49911 H3'*7‘5'j"E'5‘ 13r'1-|5;'E9__ _ Ii"I’3’ I :'. ?—-Ixiernt Case No: A-1004 »'s“SWr 1°" sac: Elitte Examination re:-c;11e;t=_-:I_ by: addressee Cow t.ns-- - FlE.‘: _ g d I'_ » €;".M.z‘z;M -Hi!-ea:-um" W - --«Q5155;-,cI_f_’_I_9-feta-nce comfi-uunicqtig n.-: $111231 12f3,-"E9 ,l§p__e_-ziluens: Name us ects- ' ; F 1;?‘-” .tzM.mJ¢Wé4:¢:¢”/¢-—wgéWa£§¢:w Heguh °‘£ ‘5"‘°5U'i-?'*7u'31'“ Exominulicn by‘: _ Evicience noted. by "1-{}v¢¢){§_1L_b___ Nflflflzi/;,4f_., a.m.¢=. ,-s.,,_:: % %/24¢ W am W;H.4.,¢.« -=-;/zfa-»-. 5'3‘; ) I P)‘ g:' (f‘C--F) is I fiigbfikfll .. - ' E i i 1 Examination camplgtg-d ,I_'fi' 1 ab L1" é" Dictuted P -1:’; L J} Time flat Dq _ '“' ''''''' '-'-':4e-w=caa-'..=m'—1:.-'=-r:=o-r:'- '--.5. ---— ------------- --.. ...... ___ __ —.— ._.._.._......_._.._.-._.._________._,, ============================================= ./texts/FBIZodiac4/53.txt ======= - F1}-.33 Tfiyr. 562'}:-El] FBI Dme: Lzksxsa _fTg-ya in plhlillflgi w :nd:,J ' $13,351? (Art: FBI Lsheratory) _ Sfi§3...5&H.E_15~FC1$'3° ($323.6: tr:-.. _sUB:£c¢é. zoning. ' ' ~ EXTflRTION CH3: Sacranentu '.- fi-_- 3-an. Eranais an . _ getter: - letter" was dai1y'newspapar, and fnrninhad to thiI“aEfi:e.%=Hcfifiequcstpd '§p¢eimgns_g¢tr1hutia _ '.1E thin cans.“ DIRECTOR, FBI E9-il'39.lJ.)_ I-flfli .- J- 'I'|.‘—E'.rE:|.1|"E. 4' Fri ari WI} use.-"é 'phutus=éts."u&~a' ¥§Sz~}:1'.n‘ga' ':;5{j :'n'ap'-act ' Re San Francisun air-1.-a_1__1:a thi! Bureau, _l2}'9;‘EE. - ' ,_ . Enclusaql. fan the Eur-gal: are ‘two phntne¢pi&a__u,f:_._. =_ “”i!ttBP Pfiltnnrked ?airfie1d. Calffnrniag 12!?IaB,'aafir££§Efi to the-San-Franuisea "chrunic1o‘, Stu ad Hiasian Straufa, Enulaaed far'5anrananta is one'cnpy of sand J_‘.' Hullncide Evetfl E;'§_.1=I_ni_a:¢_E‘a1igau_-_ E. “. Insp-a'e'tur id~g:T.aad*_1:‘h'.-it‘t'ns"' ' d by thl Ban E:h.r¢_fl-§.E:J.-C'.'f-fIl. 9-55 that tha handwriting on thg enclosed spediman he'cbmparcdfwith:; _tq unuup, flhichrhurg previéualy submitted ' Thu Cryptagrnphy autionlis fiequasted ta a.n::1y:e 1 ~cEe:11a ¢fi F19:I.t1::i.sI:u "if any man; ‘NJ 1' - Bu‘:-can (Em I. ’£fl'L- _2 - Sn-Erlanlntu (final, 1,) 1"- 5a-,n- F1:'-a.niI'.-iauo ._ -5‘ -._- :afi4fi?;5Tfi“"eh ._the cfyptugran appuhring o the enelasad letter and can ha deciphared. _a.:_.1vi_:c_ E .FLppro\-‘ed: 3tj2IIH.'1|:l1 Agent in Chqxgs ============================================= ./texts/FBIZodiac4/54.txt ======= J _.’_1 _ -...._:__ W,-' . . » -__ __. FEDERAL BUFIEMI 01-‘ IEWESTEGATIUN urmeo STATES DEPARTMENT OF JUSTICE 1-413 1°11-E Laboratory i\'n:>rk. Sheet as: zonuc File e 9..-1a911+ ‘Pd? EETDRTIOH - Lub.# CR~13443 K3 D0: Eacr:nIen1-.d' - . - Eniumlirgalic-n re-quests-cl Err.‘ -San, Francisno, airtel dated 12_a"Q,:|'EQ ' [Exe:nlmitt<$n.:eqLtesLe_-d: Crpptanafiysis I-“Dd-éum.an't Date I_&te§r2-cl,‘ 12.!'11.:I’B9 H-3~5Ll]'l of Examilwticsd: _ 'E:vuImiruIt::;:>n 1:‘ - xu. =*»’W&4‘£'-"tf°“ 1:5’? G : ‘E I?‘ II‘ _ 5-L1,. 5E|I!<'."lE|EDS Sfibfflltiéd E-Eu: examination Qe34 Copy of envelope addressed to “San Francisco Chronicle." pastuarked Enirfield, California, December 1, 1569. (1335 (hpy of hnndprintad r:'.n:|In11J.I11I::at:i_o;:| ‘beginning "This is the Zodiac speaking I juet need help I will kill again” and ending with the symbol "~f]‘}" . - ._ru-'.".- ============================================= ./texts/FBIZodiac4/55.txt ======= -g ~. "W" .= .--», *9-.===" ._ . _ 1__}_,g |.:c._, “°°“”ED uazl-figE?5rEi*?g$HrE§gaGal:~:tNEVNE1§gflrgfiE;%¥cE I “W FIE 1lJ'18.fE§ TE L,ubcx-utcnr Eton,-I: Sheet unsua, ' . - Pm‘ "1.r.:11a5$ Tina! - Herald," me: 9'“911_fi?'é’- Vallaju, Califcmnia. - ‘3'_idt:Lm; Lab" D"r'§111Im53 PI" Extozvtinn " - - -. .. U0: SAIIRAIEEHTCI T__ Em"'i="m°" *9*4U~9**=°°‘ *5“ san '.Pxta.11c:1sn:o {sauna} 11:11,-'55 Estorn1nat‘tE>n,J_:gq_u-esteél: Dncmmnt __ crflfmmiyli‘ Dot-e g-en:e_>_in.-ed; __1ljr13'ir5'a =.’-lesI.I|.!. of Exammctiun: : ’ _ Ekuminutlou bfi Specimens submitted for -Mumtnation _% E1213. Phntuanpy af anvnlopc pantuuhd “Em FRAHCISEU cALI1-'."|m 1%! PH El Huh“ bug:-1;; hum: pvintifig add:-run -' - - "3. Pa Chmniale Sm F:-anexisao can: Plan; Rtmh to Editor‘! Q22: Phutnunrpy at nncauputying hand printed Illlilli six-page H‘ %:1:1"_:'cr+,M££r::J J:r;E"£rL1jvaF._i.r_I!:5"'_ in the zodiac Bplflfkifiiys-r1r‘3' Q01! Photae of Inamd page of Ian :13; lunar b-aginnin “if: 1'19‘ llinmz I van ‘|I!'£!J1ll‘fiM."l!'l¥ f _'g-Ir 1:11:-_ guards. Ail 5.1:. Q53‘! Phfltndnpy of third plug! it! la-nanpnnyigg litter hgrlsming "3:-uups of bar-king about 13 min npnrt dun i:he:_.,E_ (11:25 Phutuucrpy at fml:-‘th pi: -ac! muhnpulyin hirginning "Takl am big of almn H-‘II yitratc fl!"l.'1 1'51.‘ ii I g'a1.,."' qcszs Phutzgzpgfogogifth ‘pug; £uf£am :|::u “""”"'§ ’_ . » q 5‘? H'r"1'3='»+~W‘- ‘M7,’! ‘) In-mtimud on nut: pugs} 2 - 5a.=J:-annntn l:‘!'‘-';?) Page 1 3 '-u——..-.--»qgu:u.m-\-w..-...—:-.——.-.-.M.:—.._-..—.._ ....... ._...—.¢__T._...—..,v_._.__ ___ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ E _ N_w__ _________’___ ============================================= ./texts/FBIZodiac4/56.txt ======= aié gag- Qo21 Photocopy of sixth page of aacmqaanyigg lntiiar beginning "thn ayatom checks out from land and to the other _I'n.'5f...-"' Qoia Fi1otooopy_of 1-ovonaofiido of 0:22? boorir'Ig"msoaLga- beginnirng “To prolin that .I am 1116 Iaodiac.-2:33: tho. . ." and ending "my collecting of alavas.“ - Quit Photocopy of entlolopo postmarked "SAN ?R2H.i-ICISCD ca _ HGT I P}! 1959,” hearing hand prvintnd addzltnn "E.I‘.. I'.'EROlIICL_E San Yuan Calif Plaza: Rush to Editot:-"'l K '.rH T.'.i.-M” frlont a'n"d.'hac]c cu-f Qc-3--tit: of 1" ‘I i .1-zo .:- .- : ' .' . §‘l:u:L£.o Gard. bnazring tussagc blghmlfig "'B::rrI'_i'_.I hmrn_.n'1:' srritteaa. Qefil of inside: of (1:30 and banning hand printad . massage beginning ""l'h:l.s is the Indian sp-o.!.iJ.ng... ." Qtzfli Phufocupy Inf ciphurv acgcmpanying the quit! £i.1‘:'d Qual- -. _ Harri za 2 n5§311na5a LL .' -mi :w_.M.°,,..m__,~__m__,___,,_°_,___,‘i.,,__m-..,un».-».~- .... ,._,_ T ______v___w_M_ \ fo- ============================================= ./texts/FBIZodiac4/57.txt ======= 'key as part linear and r Meésage overall useiefivarlants B -Qcflfi too ehcr and with third be gc32: <'“Z:_,,' ' EDP runs sliding 'situation5 {nu me I shall, I '1 and second line ha new Lieee in. 4-5 Identification of F . commonly used three values for B, M,'F "F" as E and "B" Word-Fzodiac” in Word'1De§th ma h J 35 ; firet half portions identical to and ion ing usee by Zodiac}. thdt.me5eage backwards cute transpocitio Possibilities-[li3ted—h subsequent EDP run 5.. word through tching of var time has onelwithflmesc 9 written ckwerd etc. untill +09’ be erami -letter rever which are in El and vice—versa. the\firct 20 an c ine" for entire Qc33 cipher text rth lines as end~"F" and , with I commit have a. small m. tell t. a last lo meesage. and iég: n31 la meese e exce iantcg: kil come age as oritten and cnxe first. oolumnarly. .'ahout to t, will w ning Zodiac cal; Expans frequ "EB" ‘#3 La! " - -';-_.-.= J...:.-. .'5hit thatf'eha1l - ._your rocks, hes been 3, f exem elpwJ .1‘ E91” -W .r5'U,e.‘£I§ e., H "Chri5tmass” [knc ined for cyclic. incorporated into L=P£DEat'£3§ _' @nagrémming'ettempted on , WEI, and U2} pt for impossible- . killed. killing; Sacramento; 5 an Francisco, get your- f cloves. EDP runs sliding wqrdgjhrough messages except fflrrimflflfifiiblfi filtufltiflnfip with uagiantc grouped above on one run and variants Biuurrao ahdfi and H: } on other run:.-do-my-thing,-slaves, collecting of slaves, kill. killing. killed collection of 51ave5.- -z_- - . my afterlife, plain- eefimptinns line,{orwaxd te§%fi¥ar ;+' ion cf this to include ent contact with t places. he three wn misepellr' _~ _ __-,_,._1__.-.. ============================================= ./texts/FBIZodiac4/58.txt ======= Cancentrsted anagrémming [cont.] fit 53:. took. look, bank, cock. shank. hook. At lfifl: shall, will, all ___ ' At 165: kill. killed. kills, killing ‘ ,i _ _ At 212:" shall will , H ' ' _ At .312: I 2::-.11., I lci1i&d...lJ'.ku_!l}-3 _, - ‘Special listings: _EDP-£p;_each pharacte: in flc32.and charaqgers -9 tr +9 EDP f3f'Zedia¢ plain text. sorted alphabetically by words, and words approx. -8 to +3 ” L - - Stutter 23 anfi 35 in Zodiac plain_text and decrypted me5$age ============================================= ./texts/FBIZodiac4/59.txt ======= orc.-.,¢u- {I2-3-EH5] « ; JGUGDDK FEDERAL BUREAU OF INVIEETIGJLTIGN FGIPA D51-EIED WAGE HGN SHEET uf P9.g~¢ES}\!'if13lM§I3.€7flJ5£'8l}'=I!iIi5!DI3xiunhnth1:fiJu. OnJ:ou'morccvfti1.c§b]JUwi.n,g=1afl:xucu£5,V9uvhm-cindlcaxaxj, arpLa.i.I1 TJ1.i.t- dailaticln. ‘H De1c(io.n.s wemm.a.d.c }:rw:sua.uJ: I:A:I1i1.ee:ae|:np£io11s iufiinunadbataww-imm segmegal:-lemamrlal avaalamcfinr I:I:l-:aa= tv :N|.I- fi_51i5é='=fi0 flafi '3 fblfilll El (b){'-'3(=*=) 13 853115} B {W32} El t't-If-'3I.'£-J an (M2) El {W3} El (“E-JI3T.‘aI§CJ El Gcbffl H (7=>}ET}{D}- El E1=}{2II _ U ILWTJEEJ U |I*J-$32! _ El rh}['?J(F'J _E| Ifkl-£42! U I.’|=-J14) III 1‘bH3J I:I 11:'.IC5:- CI Eb}-£5} I] M393 13 um»:- I:I tbhifih 1:: mp} El Infiomwztianm anlyw a!JaiI~dparr;.IH'ifl1:2o:\ef-3% suhheaubjaact ofyoflrequgt orflue 6-'u'hj&:‘.'l:1}f)'fi1tr xwsc;-mt 2sJ.i:-Lud.:'.nt?:u: Litlc only. 1:‘ DDWWEUVS Wi~35135I€*1 9551330512? Gfivcmmmt aguEI.':_'a"[.'w-'5]. Thm: dowmmka ww-re mfwmgd to ma: ag-5:52.-'[inaj for r~s':'ie:w=a.|:M:3 dine-Izx Izsponse to 3-‘tn. Pages contain infurmaajun iumhheacl by 9;1uItI.ecI' G01.-'arn.1;:I.e:|1t :agau,c_I.r{iee.}. Yen wjJ_1b-oz afiw.-ignci by Lb: 1-'-E1 as W 39% "‘€‘&*3**3'55=F_'u' 0* 15113 iflformkfinu lw:-ll.-nrwingqur wnsultmwn with the othar aafiilna-‘_v\{1-as). I7-‘xgojsj w§U:t|:I.c1d iansswtucb 33 a fi.11:IJ 1-flange dcbenzliuajiun has um been made, You w-jjL'b-g a,d,1.Iisad 3; Lu the disposition at a later dam. Fags were not considered E01 release as may are duplicaajye of Pzageqs} Wilihli-MG in: the F0llotwi:I3:vafl3uu.[s]: fl Tht Fofifilwingmuwtbcr is to be 1.I—u9<1 fur |.'l:f<.'-|."<:D€-I: I:~cga.Hii:u.g 11155:: pages: -5;- 5313- -9:. M, 2w$KKKX I H Dela:-5d'Page.(.s.) X I No DI.Ip]if:—a1J'uI:L Pu: X I 1hrthi$;>=.Igv: X XKKKPLTCKXXXIKKECKI KEKPCKX KKRKXX . - |Fn.‘|rIp-Q1 ============================================= ./texts/FBIZodiac4/60.txt ======= Twn¢=I11ui .-{\'. ’“'°.".'1.'- .r'-7?-_iiT!_r=iI.I..=".'*_ % "'.¢v‘."[:a§Ir-II:';§?r‘ii'.a.f"LxrE"P§l:;E<-"-' '- ' "A ============================================= ./texts/FBIZodiac4/61.txt ======= _ ll’-'-LL. HooH_|:.'r:L51'r?: UfifiEl_ : - -'J7--\".._- -- :v.=. .-_- -._-_-_.I-.-_ -' —,-_.w...— _ _ ....—..._.—...-.-mm..—w-......—--—. ww--——m- VW_ ============================================= ./texts/FBIZodiac4/62.txt ======= € 5_.cIl'an:h'.I:I:a:I:T'?r=Ia=:=rnl=’=-v'-F'\1'WI' '..'.I.3'2..__ _ _ :. ‘ r£nEnAL—BunI'afiu DE. wAsHim:T_'n'H;" nj fll i- -as i- . gfggn. - '2. new-yp_.__. '- :=_~;s»2_;e' :3:-"E2112 "?E.‘t'£~ui'i&‘ a:-£..thé:r+éLi1*.a‘. s":-:a?:.tn'ea _ 11.50:, [J 'I:5L,at“§'PE1.ltil'Tl,:| .,_.-__.j.:__ ============================================= ./texts/FBIZodiac4/63.txt ======= .2-—.. .1i'3t<>v::op:.r;' 0f=:?:hnve1up;:_pastmnrBE' E 1313.. 4.5.:;-..1rj1-:3-_19a1:---.--_9s+fsa_a*:=;-zadéi-is ¥‘v'3~¥‘="‘*='**’-‘EFF’ . .. *3 -D33 '33.‘ 1359- FE". -a.:i|'.1.':'Ii!:£$;7Aii'1'vI'-J‘-3'8-If-I '?'£a1I'I'u3'_'a'.§n°.‘a_ __ éfififisyer I - h_1‘"'_r."i*_1.7KT-_*:L.§-.E"¢EJ-§__.- .,,£r gm 191$1,;Rieman-;Anfiex..-.&aflg;Il3AN_C1,BcEing_«; .c,a:ur_,'9h112"‘ - . - - "ma: -9- ‘ lg .1’£..wi:'_'pn”3igiua° -'=¢=ri_.t'a._.~.=M_'ivan.'=.§ _' ~33‘-'th:a'.;5bt§i' rthffii "I-‘I.Ia3t.a<:»wC|"wI_:rv-an-: nun-::CI ============================================= ./texts/FBIZodiac4/64.txt ======= . T:f1*3h7'fi‘5T‘¥'5'_'¥ififl*$5€T ‘:1 3: ifif£::a-. ' "* fi.fi__}|'._l.1.ErJ cqntnin sane: 'd;l.§1:-|1rvl,'_=1n31" ._d*__ not-.;q;~i:::¢:sa ;a-3 .~£;~e'a1§:,gea 1‘.-[:_fi§".-',-'5}; W. mg-;;:,j..g¢.__.;-;£_;';Aa:{a '1' p-r.‘.53z\ .‘r':3... Qg 3,1; ' a.]::fl~_-!3é_E§‘ :2. hd-319, _iagv.Eu __ 'g'5;_au;s1,a".:i,-aéal w - - pa 3 2. 'ni'-.':F!:é_I':l_"rifi:Ffi::’I-.'7’?1.':i-:’1$.533$":-‘L-1iég*:“i§f§ haw? i;°:_+;'§§° .P=';e1:atI‘e_s:1.,é1:-3r th '-t=_:-._i‘.t¢:'-. .:»£,- ‘:3-_ur , __ ' th:_i,sm'a.:=.t‘i*n:- ' ' - ' ============================================= ./texts/FBIZodiac4/65.txt ======= __12}2§}fifi .31; _. . _ fTj'i:I.:.in:J_;J.-51-I:|'|-5I:;2:lcI.-v.:I:Ic£;‘e.;'_ . .- ',g.;nT3L ' - - - A AIEHAIL __ __ ' Jér-’-anv:rJ_ __ -_nIR£éi'oR, E'BI--(‘Jr-I-1535511-24--'.'_ .. , .~ :AT:EN;j;g;-_:- ,'_-_rn_z___u».a::»__1_2_.-v.=u:<;~,;1-:1-:s_ ; ' ' ' ' _SAG,- -é_n.N- n=.n.1&cIsc:o___(_§—;2.2'5i3aJ ch 'airte]:.”"l: nnclosad liar 1:,-‘.1-u,=_ nEu;:;s'ea1.'q-' _ zycez-ox.':".-op5r_-_oE "a 1etta1:‘;«' fun-é,'1.'n:s +3‘ _ __wh':.r::h .5-.nve1a Depa.rtn_e:a1._ 1'9‘?1'?‘1'."515°-.?‘°.‘1t31n&..a"IP , .- .. . _m:-'_a_1'toz13r ft'ics'T.'s" hajré dfiterminéd‘ clung ' last known'v‘iatim in this case"; __ . - T11-,3 FE-‘I ‘I._..=..1].\:c:r-a1:»:_:_i=;§.r is :~e-:-Q11-_a2-;‘t-‘Ian-:t-._t_é' .z-.o§1 "a.ppI‘:'rpr'ia.te'_e:ca.m.ina1:iun to’daterm:'Lné._=-_"if_- the:-;env:z1a_r\3u;:‘*-2:5 ' be attributed to UNSEJB_ in this matte‘:-'. ' ' ' L%?**W°;*%% é%+,<*€;u=:~ El {km I3 u:I:)fi'J5- ' ' . - ca. er representing himself to he ZODIAC contacted the -- -='sa_e5_eeeatn re: Office and identifieci himself .a5_"ZOtI13i.C" and stated that he had just. killed {unintelligible}. ._ San Fra.ncisa::o_CIffice is requeste-fl to pass this in- -formation on to the Sen Francisco Police Department. the Napa F.~:;.,cos.1n1;3,r s|;|.e::i_fE*g. Office, anfl any other organizations inveetiqaiinag -- the rzenrec“ killings. ' ' . The Sacramento Pei.-Lee Department, Sacramento Cflunty -Sheriff's Office, and California Bureau of Crimin.aLl_Ic'le:1t.f.fi- .ca_t5_,,,-,_ and Inveefigatien HIII} , Sacra-amente, all were flmediately‘H; acivieed in an effort to connect any recent homicide in this area . tn “ZODIAC.” -_ ';L‘his infgrmaticin is also being made available to_ the ' Vallejo Police Department which has one of the crimes which appears to be connected with the person calling himself "EDDIAC-" E1?! p‘. ‘Eb’ -_-..n— @}u Bureau (Eric. .1} I-?u‘.‘II| - San Fransisco (Eric. 1] 2 - Sacramental .‘.?g'5:-1:19’ FtEG—3U ?“___ :£F§'C}*J.r-€fl ' H.135 _ ' —- H-~ -~»-=-= .--:_=;_- -. _‘1_:_ JRN :3}; mm HQ ‘ §9‘l‘E‘Nl979EU I PEF§t}E I I Big! U..5'. Easing: Beards Krgwimfi an :81: Pgvmfl Inning; Phm —j— ---- —-..—...-..._.-..-..—...—...-.....—..—..—...-..-.—..-—-.. .—.-..., ============================================= ./texts/FBIZodiac4/71.txt ======= » L» - .- At'J.:59 9.1-1. on 1,1/2/{Tun-.a.5 acting switchboard 'o;.arate_u;—, 1' "tn-uk'a call from 8 man who, without further identifying hi-.11-aalf, E-aifl: "This is Zodiac. I juat killed . . . ." I did not; catch the name or idantity ofi- the perana he said he killed, if_ in fact he aid I1-EIJBE someone? I got the first three words, after .. -ant;-,§PfliaC. and than 11:13 voice began to soften until it faded away ___'E.l'1"Ei-.5-"E11|'. Then he hung up. I think the call was local inasmuch as it came in _ on the switchbnarfl as local calls do, Eh "Xvi; Bu; U.J'. J'au:‘rrg.r Bond: Rsgxfsrfj on rile Fqfmfi .5‘w:En5.r Pine: «—..-... “f_\ffi_l-'. 3r___'......u'.....L.' Wag; _ ' =;-!u=:::-‘nix:-nu ‘‘___N - "-'.. UNITED STATE_.5 C§3§'ERNT~IENF Memorandum T0 -' sac: t9—ea: _' ' DAT‘-== lxzflu H“-“H ‘ §? fif0R '3-LBI~.‘I< {RELIEF SWITCHEDARD op1em=_':'<}:=.} sum-ac-r; ZODIAC -v->—-o—.—.——-—- —....-—.—v—.w..—...-..——. ---..—..—._._,,.__,,.,_.,,_,_-,..__.=,w,,_,_,.. _,,.,,__. ============================================= ./texts/FBIZodiac4/72.txt ======= 1111'. ‘I'u5-w-rl—«—- - _§§HI'h13Zl|'35-~_- .~ ' '5-L::ss:.;_:§$"~"§§-'5-= _,_l.. :'J-'-.'x ============================================= ./texts/FBIZodiac4/73.txt ======= .-.. _ -_.__v .' " I . I-aI_ _ ' ' _ . $19 ( \'h.1-nu-vwzf---i-n nnnv .-__.$: 3‘- .' L ~$»_~~. "‘”11’;i%A§-4%:-.’f<}a.t1JJJ1:3]2€IItj'VFiU315>CII\°:‘fi2II°:n.D¢ ‘t01l1.K:E|.1E|jEGt|2|-f}"(}‘l].1'1'Ei1‘[l.£.‘.SI o1‘t.1J.G5Lih_iefltQf}'0llJ: I'.:1u.r.st Eslishcd i1:I131e:'L1.1e-:m_13', El Duwmcnts ofiginawd wI'Lt11a.ncn3:.cr Guw:nJ.1;ue;ut ag\:1bcy'I_'Ies}. These doaamnwts were 1'BfIasI\a_:d. to 11:33 agcaqrfns) Eur rvrviewand d.i.1:\ect mgpo-,nc,t to}-ma. Pages Isuntain iufarmalion filmishod bjanothw Gumnmcnt aguncyriius}. You wflitkz afivlseil by me FBI as 0:} (bx rail:-‘.1-sa.bJ'JiE)-' Of this iI:IfEIr!:|:l.=!Ii.@:U. ftllfiuwingeui consultation: wifl: the Omar agaucyfiea}. Pagafsj withheld inasmuch as a fiml rtimr.-2 dmrmiuafiou has mt bu.-.u made. You wiJ_1b-e 343-.-35¢: 35, 59 um dwsition at a lamr dame. Pages wan: mt auusidczcd fur rzlcnsc as 112:.-23' ax: 1:1I.rpli.I:aJ:i.v¢ of Pa-gc{sJ' wiarm-:Ld for time ramming zv.:—13w1J(5).' E T11-2 fouowiugnumbeg tstcu be aged fog :v.:fm'<:D.-c.I: m g 11125:: pagca: '- '1'"? I -‘ KEfi KXX K DI'_‘l<:[I:|'1 'i’agq5} I N No Duplicaiiun Fm: K K for U16 page X KKFUCECXXXKXXXXXK IXXXXX .3=C.X.X3‘U’-(K XXXKXK . - I-'SU'.|_'I[.'Ir ============================================= ./texts/FBIZodiac4/77.txt ======= 4. % **§*'.r‘£L4AL' B". Z.‘ "§.v'. | L13??? ‘Iv % mi? - .- .¥a?r_ ~’~. ============================================= ./texts/FBIZodiac4/78.txt ======= ============================================= ./texts/FBIZodiac4/79.txt ======= '1--$5 {Em-. |_2|-fin-$32! ‘iv . ?'E|I|E§:l'e’sL. EIUHE-RU OF [NVESTIGRTIUN LATENT FINGEZRPEINT EECTION WORK SHEET FE-3«ccu;d.3d_: ].J"5."”I"|.'} E‘ :51-,|_ E: . ITI. fig fem um, Ne“ 9 -229$ ' _ FEE File No: 9439911’/gZ' Received; lffiffg _z'_[_n Lalgn: Case No; 3- ]_{;I[J42 Ans we: to: SAC , ‘-731': F:a1'1¢i scab " I. . — — , _ Exflminfltiun requested by: fi,.§.fir.35_5ee Copyao: ‘L SAC, Sacramento ‘.'-"*-d53 -v.-; _ HE: —- I ZODIAC ./' El"-T['{1E.I'I DDT Aittel 12f31!£9 /” Pm? of E-effifézlce communication; ' "fi-ecsmensz .r_ Named Suspects ~ See attached 'list Y. 06944-62 ~=«r #5 ma: :4?’ Result 35 examination: B Eawminutinn by‘: - Evid-=nc-a nwted 1-.» ofon-154....» E§n,.fl ?+H»uJ5,¢~,.£;2zi?n~flMgfhrlfl?“_x._M#¥_£“p4|’/g§,4‘;‘,:- 3545'"-- ;1.L../.4,_,,4_ L,‘Ir_, ~. --;« ..:_! Ildl :.‘I fir. «J ‘II/‘I A Bflmlnultm completed _J'.!J!c|P=’ 2' 75‘ Uictcmed J % 3’-'-"_ me D 2 tem_ ============================================= ./texts/FBIZodiac4/80.txt ======= or-:-ma (123301 ,3 XE-Dixxx FEDERAL BUREAU OF $HON FDIP,-L UE.LE|."BI.| P315-E HQEDRAIATION EIEIEEI E! Pagfis} vritllllcld vmlircly at fljjs 1::-cams; in an-. mg. Gm: Err mum of the iuliuuriaig sta.Lr.u:I.m.[s, wage 1n,.1;.;;,;.,.¢__ c:I:p]3.iJ1 U333 écfiujun. ' PI Dalefic-as 17-Em mafia: ptztsuaai. to am: cncawptl-ans indivamad bclcrw a-imno ascgmgablc matnrlai a.\'“.b'Jabie Eur mm: to you. action 532 Ei {bII(1] El I:ErJ-I2"-'3(fis.‘1 E: (d)(5) U GIN?-3' Cl Iihlmfifl} 0 Kim?) El [bum ' fir fbJv£?}[C—'J 1:: rm) E1 {|=".3f'5'1-{I3} E1 {KH23 E3 Cb}|.‘7J(E El vIkJ'f3I' El Iftr}-f?J(1*'} E4 1153(4) '3 'fbJ(4I' El WH3) ‘U mm '3 (W5) El t'bJt‘92I El 06(6) El (1<}{’7J' '3 §t>}'[‘5} El Infunnation péflained only to .1 tfiini petty 1-I-“M2: no mfsrmma ti} Ihc subject ufymll mquast -OI lhe whjmt ufyou.-r rI=quI:';t L5 llsbcrd Lu the title only. CI D oflginabad t\I'i€-‘it m1.n’.‘a-thtI- Gm-|:nnnu:|t agGDI:)'l:iE5_). dowmzqts ymm cefm:-n-.:1 to tbs; agcnfiyficfij for rcview 3135‘ d.1'.1'ea:tre.$o.n_<.e In yon. ' F3fi|'5 CrU|I|'€F\-in iDF0fi'|=|=fl-l'irDIl fF~fi1iEh9-H by-an:"|i1.Ekr GG‘-'\9-'J.'£1I1i$EI.E agmaynfiiesj, YULL willba advised bytha FBI :: I0 15143 :r-t1&A$a.EIE1E|:j' of tlzis i|:Il‘\:II'ma£i!D\n. f\:Il]\‘.|'P¢"1ng0‘I.l1' comultaiiqn ';\P5Efi_ 131,-: |:;q3J_g|: Pagers} widabmd inasma-h as a final tel-2-ass ietetminatlan has amt been mam You will 13-: ads-i.sc1:1 as to the djspcaition =3! 3 [amt dare. P9333 were not mmiduad for rtiease as um am 1i1.Ip].1'.I=eIt'wI= of PagI:[.s]I wiflzhcld forfllc following rcas:::c;I.(s}: H T1-:9: full-vwing number ism be used in! §‘2fP.‘.:IEE|C.-B regsmi-"nag 13152 13336: ' ' ‘Eu ‘F5 ‘3..I'.r‘—- XKKXK7fixX 3 D¢5¢1°d'P9»£€|f$} X X NO JZ|up'|in:ati.n-n F9: 1 X for 1.5.15.1 p=f_:_I: DC 3(}€J<:<:3{xxxxJ<'.'c KKXXKX KXXXKK XXXKKK - FETJI)-O_I ============================================= ./texts/FBIZodiac4/81.txt ======= F343 Iilg . s—3'3—sa| _ __"12_:‘_29 .-’ B__E_1_ '. i|‘-.‘;§.l_I-Zl:W§r|q' I:_1_ - - - _: frwq gnpiaintlexf cu cutie) - -. ,' /, RI‘iAI'I.." ' 'H’r:'oI'I'|5i"J'_ ' ._ EIIRECTDR, FBI (1-1!-‘:'l!':]ll}I - ' '. ts-I°rENT.I. 'a:T.1_"=t'e1'_'l: fBu):ea_1i -:r.*2’ff_a_'5 ‘--. ,.- - .s --. .¢-.- h-' - . - : ‘w ' - L¢. 'H:;mi¢':i-ga Detail ., .1=;_»_ _ 5335’?-‘w - '_Pn1i<:-.3 Deyifftmfi ; 3- . .59‘ f‘-L"‘1'115ne‘5~' '- .9]-15"” EI=~._-'13‘- 'ef names as possible éus a ‘ ' ' 5Ar§‘htE5wfiiTe5v“ \ . éfiéeau - .s.Saeramanto {B-E33 2;- 5 __:_-Franaiscp . 3 1-‘ " ' 3?? étih} V 9 x Ecnt Specjui Agent in Change ============================================= ./texts/FBIZodiac4/82.txt ======= _a1a1~:::'I: }='.'Nii~' ‘E111 ============================================= ./texts/FBIZodiac4/83.txt ======= ='s2=:gw' I kt‘ H 43 Jam s:a};_o.=&=r .-5 r::R'.~*:s:.ra':o‘r+:m 0F}f.'_CML U55‘ 9-jmr ' ‘ ' ..g.- x.,-- ..-_..:-, ============================================= ./texts/FBIZodiac4/84.txt ======= --v—~—v--v----n-wu--a-——..-...-.-..-.--.-w—.—..-..- ~m___~-...:fi-j'__.___,_._.._;,q_unHqA~H_..;_~_P__'_fl1_,T_g.u_.,. _ . ============================================= ./texts/FBIZodiac4/85.txt ======= . Enctrminqiion completed ‘I5’ ‘(I131 .3 Time has cs;-£5.-Lt-3-s:I: FEDEE-5.5.. E-URE'."'.U DP INVESTIGATION LATENT FINGEHPEEVT SECTION WORK SEEET He-cn:\rd:a%c|r 1300 Pum- 1'3‘7D Reference No: Fleceiveui: 1'3'7fl FBI F139 Ne: 'l'E'I11 Answer to: SAC, San Francisco -" Exuminuiion requested by: addressee Cue‘-*1-' to: ..'.i—?:‘-:__lh_,£_-;'.«:.«:1..«~»~e....-'\’f‘e- C‘? " '3' E} J] ,. FIE: 1- - - ZODIAC EXTCII‘-|'.T ION /’ I . --zfi§_B_-_E|f2l'$iEf$:l1.<:E communication: , Sfieciroexis; Ha Airtel, 12-29-69 '/ min!» * watwnv” DOB ' .. p.‘I'.rL bqbure n-an Wu -/ 1 HF*- Wu /a_[,u'¢= j max v’ H-M‘-uii Bf exggflgfigntfued an Page 2) g(£9.aJZ; fl (11 ,=,-’2...u-I. DOE E mminu than tn 5:: aw: 9—v22El'F3 9-49911 «_ Latent Ease Nu:J1-10042. / ' _ . Hm "’;.fi._,- g,-2:; Evidsnee noted by"- .1" #33 x --.- .—r'\.g- ============================================= ./texts/FBIZodiac4/86.txt ======= Page 3 I ~ ' Reference No.: 9-3295 ' FE -~.—,—.i]_E ND-.: 5--49911 La 1. case 1{o.: A-10042 HI» _flpEcimBnS; tcéutiuued frum_Page 1} Named Suspects: I ' ' ” " - W ============================================= ./texts/FBIZodiac4/87.txt ======= _ u.-nn»AJ.:|=oIbI-uI‘:- Ii . My ntn . n.|.nlIivLAI:‘-||fl|I|""||.3 . :l 3‘ ‘fl UN1']"E.D STATES Memorandum ~~_ DIRECTOR. EBI D*TE= 1{?f?n : :5; _ _ I I .-x I JACKSQNVILLE -:62—J,;:?:I {ELSE} . . " ' wmfifiF%ommn I ' W_ _ H. . ' " ' ' _ I1~TE'I::1=-.2~1:s.'i'I-ezm CUl:ICE1‘|i'-TING ' ' - - ' ' " ____g_c-1.15:3 cpo1>E§u;_I_Ir:3=r ' '- 'r _ ' -_..- -1. - ._ _ 1? --N" ._. ?$?§$£a%¥m%+r?wgfi§$¢Ee3a? " --' ‘ _EE_M%flPhi5 aifite g3". - H jt¢.3ureau.$ ---.-' 1. 2. Tié fQLlflwinfi puiiéé departfiéhts werE'Edfi£aétEa 5 I _ Lri"-:;+'fr:l ' '15:: de :2 ' e if they had any I‘E1:o:|:d.D=_E. a.11a.-arr-E‘5_“l:. _ - - B1_ ' 0: ‘n appraximately 1952 for indecént _?1 _¥-” ?*g§p sure. _ Dne_a _ e_ epartfients contacted hafi any-recprfi . _¢jn$u§h an arrest. Ft. Walton Beach Po1icE_Dapé;t$éfifig._... :Eg1in Air Force Base security foiice -Dkalficéé C§fifi£fHSEeE£ff;§?fif cfl Walt/an Cnunty She=r:'L£f*s Dffiicé Hicaville. Fl§.; Pniice Dé§$§£fieflt Valparaiso, Fla., Police Department '- l-"ix A check of tha 1952 uitf airectony and phone boék ' far Ft. Walton Beac wa mafle‘and there was no list- 'ng fig:-r a R - on 12fBfE9, Mr. fozfiar_invmstiga£dr'” fur the Dkalooaa County 3 _¢Dnt§c§sfi”an¢‘ N” ha statéd that he was the Eéx the'flKaiqd$a- H _ '”'C0HDtY in 1952. a vised that he cuu1&'not':e¢a11'fihi% '_fii” _inai?i&ual 393:1 ca 3, but he stated-that therq_hav¢ beEn_'_ many instances where man from Eglin Air Force Basé‘hava?baén= er arrested for indecent azpoaure in the Eglin Ai:_Furce flase and Ft. Walton Beach, F1a.,_vicinity. fie statEfl_£hat it 13 quite possible thgt there is no record an thffi case inasmuch as rrnanyfqf these men were merely turned. aver tr: 3%‘-'§§§f,3 == an JAN:-er“1§i‘ __ HTTjpen ' _ (53 ',.§‘_ (fa-.a.-iny Emir Exgsfsrfj an IE: P.s:_“1-ref! 539%; fl‘?-fi"' " ' ============================================= ./texts/FBIZodiac4/88.txt ======= JK E2-112? their commanding offirsvala;-as 6-rithau +.-.- being .fc.u_-mgrly chargu-=_-_-:i' " -l _ by Civilian 2113!.-.11.-::rit.J’_e.=.-. - ._,_,_w_,._.L. ....___._.,_r__._ _..j___.._.....,.._,___ __ .. ,“ __ _,.. .,,_._ _, _,..,. ============================================= ./texts/FBIZodiac4/89.txt ======= W. .m n.. .1 m .r W. L. .w ============================================= ./texts/FBIZodiac4/90.txt ======= -.. ' .9’: 14r':'~M%‘&*e% H1"r’§iF1_l°P~=:% ============================================= ./texts/FBIZodiac4/91.txt ======= BIJJIEAU 3;‘ OF;-.. ill . rofi. 1;r-.’- :3‘: 2053*? ============================================= ./texts/FBIZodiac4/92.txt ======= 1.35 IfE|_-1. L!-5-G5] J '/H FEDERHL BUREAU OF INVEETIGH-TIC-N LPLTE NT PIHQERPHINT SEC TIGN WORK fi:E|=°€I~1Ed= 1.n'12."?0 ' 11:00 a.n1. Heia=ers-=-3 No: 9-2295 . - : _ ' FBI File No; g_;_a;}gg1'f..-I":‘ Dir. 35:-':ma_é‘— 'I'r.~I.-2. 11'.-vmI_.——-«- mig; I-I5i|:I8B_..-.._ Mi.-as. -Gandr.-_ ============================================= ./texts/FBIZodiac4/95.txt ======= l—a.. -{R_-1.‘. L|:$»H1 F'EDEIH:'~'«L BUREAU {PF iZN‘h’E5'T IGATION LATENT FINGER PRINT SECTIQN WORK SHEET FlEC'C|1'|'.iEd} 1-9-70 3 :15 a._::| , P';EE?|:'3‘|fl\’-"3' NI:-: Q-2298 . ' F311-use No: 9-4991} ~33?’ l'1':"IITI. : ' Ream-«'9-.'|: 1'9-70 Latent Case No: A-113042 AnsweI to: SAC, San -1?-:anc isculfl Exuminaunn 11:.-quested by: Add res 539 _ .. __*'.3~.=v='=+?.=_.,.fl «"5J“’*‘~‘***-°*”"$ ‘~53’ *9) "sue; i5fi:Ac'- ' ' ' ——' ' EKTDRTIDN ' - ' _ Di :3f=_rt-an-EB :0u:IIJ1n:rIi<:cILiUn: Teletype F ' -"§E“éi&i‘I'g1e ng: .,._ . January 3, 197!) Named fiuspefit Result of 3 xcrrninu tion; E5‘-I (.1 Elfin |'t3|1£lC|t:i.'=||-'|. h:.r_ f ' _ E-ride nee noted . -.«fl;‘i‘*’5“"3‘**a°°v Jm’: 1? .% .//_m:.“:' I’/E? uh %a~**‘%‘ Efiflzninutjcn '-TKIIWDLELEC 5'. .\!E-''‘7 ‘'3 F: 375:‘ Dictegtgd r",-'_" fif Q mm mm CITE ” % % b’1"-’”°B- 7 ============================================= ./texts/FBIZodiac4/96.txt ======= - ..1':‘.'=:-.;.'.._......'a_-_..___,,__ __ ;fl§ aakisfi Pngpfi; .;a 'ar4Pm=u&sfiuf i—i4-we ms "I Mk 1 9:".-*%3 7 '- -Efififfiasaaa ’ A11u='1aEfi%:firy;sIpu :4 -as mg. I":'\. :__ ID unnec R (3449311) ' ‘ _ - .- _ . '- 11¢". ~E:~;£nts _..—' FRDH nu Fnanulscn 19-2295: :9: [F - _ _, _ _ TflmRmm»—w . :. - -- - . . I I I R I 1_-4:5: Gaud.:'_.'_— ; '- :.-:9»-n . -;.- ...-->--.- . --~_,_ .. fl§Htg$hfi;a1RTELED§g§flfi 3&;ntn{{nYfia_ i 5.. an a;.tfi}§;1§;§_‘ _ 1DE|!fi]EHLL':; }!xEL'I.'_l§En'-'7‘1‘__q4':4:gi.'¥.I1.*.§'.’.'~_E13 I -«s€-§_ . EIED, ZfifiiiégfvIELEPHQfl§¢$Lg§;CD"jéhffifigi.- ' b;1nEH17 =:*f:‘-*'- - ‘C’. inane: 1fi'EFFHfi¥n%U%fih“ ggtggé 7” ffihéfifigfiu s:A1§D.p'1_eaHj¢ &"iI g§§§;Egii§u'p1u1sID&*iéF;£fihE$T;§: _.1n§figfigrarsjpF mzra hATEflI F1iéEgfi§iH:éf§fifimt1T _"“tH1 ";3;—11f»._-. nanEn’aua'naufiEnnus. :-Nfdfi§ii§fiCRaHEHTU.- ============================================= ./texts/FBIZodiac4/97.txt ======= I-zlaniau. 51-G-H] - ~ ' e""‘\ 1; 9 FEDERAL BUREAU 0F‘ znwasfxcnwton LATENT FINGERPHINT sacwxew we-m< am; ET R-3|=Ol'd.B|i5 ]~‘'15'TD 3: an 3-13'“ Reference No: 9-2295 FBIF"11a Na: 9-49911rf3 F_[fl'=9iV9d: 1- 15 +70‘ 1:I1j ls: _ Lvlkertt Case No: Jab, 13042 Answer to: SAC, San Franciaeo Examination hequestad bar: Addressee “C-'°D':'t9-‘__ E‘-M3, Sacramento , _ -u-_r_;_ _ .____ 'Ha:- - znrrmc ' ' _' - -—-_ EKTORTION . , --I|nt_a of reference =c-rnrnuniuantiean: Teletype l-lf-'I-?U- I H1~'_$§"553T9“5= flamed 31.15 ct: _ F9: - !' ..'..__ ' _ . . no i W31 . . _ ha] i _ ; V3 - 111 = . K‘ ' bvv Result at’ exanmf: Telet?Pe_ J? ffirerfifli Emmmutlcm by: I Evidstms untnd 1:. aw/1 -« . ' * J! 7*‘ ?-. :.J.fi£_t H_=_‘_“.u" ,5 .-0-:.1,4fi,Jr~\~..::.EIl‘.,,_J-— X3’ /3 I» _ __ E:c¢m:i.ncttion cmmlelgd 6'; "'?$!'(""] .-‘I 5". 3' 5E Dietary; :''‘¢‘4:''-'/£.r''' ‘‘ Time aaer '- Date c/J ‘“‘°=""""—"—.' W -—--r--om-oa+w.—-=u=m ============================================= ./texts/FBIZodiac4/98.txt ======= 4:94;: nt?:'1nE&T1f16aT1nu n;ui§1nfi' is-2g§si céa ============================================= ./texts/FBIZodiac4/99.txt ======= ============================================= ./texts/FBIZodiac4/100.txt ======= '“*M'n-.. _§' L..1a -i:F|5'\r. :IL-6-$3! I _. £1 - --Eda _:>_i__r_e£a,*-ante comzrI.LH‘|.'ImII1Dn: —‘ .- -—‘. - I FEDEHRL 3UFlEI"LU '3? INVEETIG-KTIUN LATENT FTNGEEFRINT SECTION WDHK S!-IEIET 9—229s- F Recozdefl: l.n"'1Z;"'_u"'U 9135 a.JII. Flefarenca Na: . - FB£FfleNo: 9-&9911 Received: 1,! 9;:-'0 H _ -5111. Latent Case No: A‘ :60.-L2 _-' Answer iu: SAC , San Franciscfi I ' ‘ ‘ ' ‘ _ Exu nunuti-on requested bur: flédreg Bee Cow tn: -é}f31_Cf_4J£u¢“..:.=~31= ' _ . -HE: I —- - _ ZGDIAC 1 EKTGRTI UN Eeletvna lfarvo ,_ 5p_-ecimansr Na W 575- Rasult 91 em: mimrlian: E3t|1l'BiJ'L{l1it|E| bar: J»,/6, .-1: E'h'_'1Iin-r|.I:.e'J:|e-insi :- \,_,,..,.£;.1_’ (_-,fi__§-.»‘»-.--»5: .' if "/7" Lifljylggl-c-f .}-‘:1-9-I-ii:-=»'~'*-"-':"":L gr-,{‘;q3‘r,.r,,?.é& ,4_;»+....u.-..~;I); _-5:9-I-c-‘-5:4-4%'°.‘/_.|§J.a;~e”-<1 fia-CH--' ,1-'.-.5.-'r‘;u!' V ‘F _ .: 394:?-tyéfi-1 /1,-is 2’ (5 if ============================================= ./texts/FBIZodiac4/101.txt ======= : if an .3. 5§fi\ph't.I srnzzr =.'i_1Afi1E: D. 'EI|:||'r,-wt: : i . |:nsTF:ICT ATFURHEY 0 waehifigton, D.G._ what we wish to know, if“pu3Sible: .I'\. i; <§""’“ 7} =I._IEI§_n:. ADMIHISTRATDR DUELII: [ELI-5-RD!--W4 .-- ‘3'3d--?'-I6? AREA '75? H/\.V.I‘h E-'\-L‘ l'UF!N||.!. 94-SSE OEFU"-‘I’-D o January l3, l,TG J Jflwuccfli 'y|7|_|_M'.|.I 11. with : 4- zutnnn wad.- !:w=r Icmcn-- w-m_|.|.- I: new .4; u;. :wfl|J|.|U O|?°'U\-Ln i. dun o9-mu |-cr\‘\-'\- Director of the Federal Eureafi fl ' kflfl’ of Investigation Federal Bureau cf Investigation 506 Uld Poet Office Building 30535 Dfilém: »n:,_ a. -~—...— - pi '. attached please find two colleotione-of writings would like to have analyzed by your ezperte. a) are they definitely written by the same writer. they definitely not written by the same writer-' c] any opinions which you might hav 3 to similarity sfli aiaaimiiarit-,3 of the Zodiac encliwritinga. - 1:-1| .5’-‘me E19 d) are the alleged tefiiac writings all written by the same hand. - If, after your anelyeie is completed, you wish to have any adfiitional material or oieeuseion, please feel free to cell the undersignefi collect. Your aeeietinne ui11_he sincerely appreoiatefi. Very truly yours, . E r’ 'k.__ r; \III,’IE.J _, W.’.’_.'_(;__r'l_£_: .-L_,k1 J . {H-::uL..-1.11:: 1.-I mien ffigputy District At unney :5 , ? .:Rw:3.1 H Enclosure.-5 .3, 1 ~s£c~aQ‘:£€:j'L_",nff::§’0 ============================================= ./texts/FBIZodiac4/102.txt ======= L - Lab file if _’ '°=' ?§|I1'iPaIz1-.-3-145‘-$'J'§ in ,' HE: ‘inf ; .. :ini.£é'_3w3'g '->z=‘-’-“““._-3&5-‘iiéi-S‘-. _ nth‘),-§’qiii1u?m guqtgag grid the} ============================================= ./texts/FBIZodiac4/103.txt ======= ============================================= ./texts/FBIZodiac4/104.txt ======= r W3§"?‘;.- . .a,51$;;._:- ffififj. 1.i_‘fi-2-_5I.<":* ============================================= ./texts/FBIZodiac4/105.txt ======= gpg_g4;;.{|z_3.-51$. 3 '4 mooorx FEDE-EAL IHJREAJJ‘ OF $fiDN FGIIFA DELETED P416331 JZDIFC|'Rl\-J..%'l'IDN SHEET Q Pageisj ‘D2-‘.'1'l'3J31.e.II3 :‘:tILh“r;*.h|' at 11135 locafiuu in L132. file. 0112 at 1:nxJn°_~ offlla finllowtug 5:312-,13:u:,n.15, whege explain Ibis ' FBI!-‘i1=.> Nu: '5--4.99-J_1..«=r3 I Lat-e:1t('_‘.dge Nor A_]_D|}¢2 He:-eivsé: F-newartu: SAC, San Francisco ' - H _ N Examination :I'gI:[Ll-%53',3d. 3:-3-'. 5311 Francisco ' '" C0DrlD="5-$53.. _5ac:I'-amento £5-SS _ .' " - _ _ F”'3= zooms; ESETORTIUEI - '§t.é._n._£__qefe['e-nee commuglicuiiun: Teletype 1.-2?-FD ,.S;:_-eghimafns: ‘. ET.5'IIEL RF.5i!LTS OF |3'Ji“|.?.I1xE.IUI-IS Re-suit oi examination: I _._J’,?__ 70 . gxegainution h::b — -n enr_~._=~ note yr: A559-Ha “EOh :lLr-‘—k-ei--‘ W“L=-t 9133+ Lie Mrs P*'‘'‘''*' ~>p+==r was «amn- S . fut: :9 _ ~S€‘.I»-It /'— I1-?"?fl _/I‘ j..,£}.5 r~.-LP’-E-. S€«P :5 Exurn-inertia.-u curngleted LP _L 1?;-3,’ 53‘ Dlctqtgd -"f‘“2'7" 79 me Date Date ============================================= ./texts/FBIZodiac4/112.txt ======= _ _::_I;:e=:»;'.-. - ;'_;2'=_'H:n;1_ '; -I"Tj";D:: E;-2 p!'u::I.II.‘|:r|:x( .-J.-_cla§:-;J'- -R; _ __. 4:5: . "-'~ r3.IRflAIL- I |'F'r.’orL'r;-'_.|'__ TOR,_E‘BI (349911) . FBI.-L.fi.E.0m.'.'_r._- ‘ -,-dian -fmggfi _ ...D ' ============================================= ./texts/FBIZodiac4/118.txt ======= nr -"- . r-.' _ _ . ' -_ 1c=<_-” 3: 1'5 ?I'3'KJV-I'5-H53 FGR C-'-F?.I'|5'.I'.2‘I.E. U5; ============================================= ./texts/FBIZodiac4/119.txt ======= I.;:.aj'FI.;g. ll-E-511 —\ _ F'EDEE.F!.|'. BUREAU OF‘ EQVESTIGATION L--‘LTE NT FINGERPRINT SECTION WORK SHEET Hecaxded: 1-'25-TU 8:4? _a‘m* firefgxgnc-3 Nu: 9-2295 ___,_ "’F-H ‘ FBIF1le No: 9"‘*99” 4:5 HE!'—‘£'i‘FE-52 1-25-?{* P3} C Luten! Case Nu.A‘]-mflhz ,q},5wEr't;.; SAC, San Francisco ' Examination requested by: 1"'9*'-'1d1-"E5599 C-asp}-' to: _ I. _ _._ __ _~ H W ' ' ' EKIDRTIQN. _ ilate of reference .:or:;rnun§n:»a§5on-. 'A:1.1:1:~=_-1. 1'21 -7'3 - "°';%1_C‘i,;'.I]§__[f'IS: 9} '- Named Suspec ts: $4“ 1.4.596.» ,1—|..n.. -l«¢<'_/L-ruff .4...-$'—-1-v-'1"|".l¢"£:'_.r£:”"(""fi!-// Result 9:‘. exdmluutiuna Ex<:a11L.-u:rt§_::n by: JW =3“ -*2;-79 an/mm . ““ »5rg»: me’ #17’ /)6//61 W) W. ,,.,Wz:;/ :4» «='=«-~«» aw 4’fi§,«é*’fj*‘*,«»*4r**a? “£3;-, E ».mé:w.I!iI§'IiGI-I: "bin" at ._1'S;+':;=___ri1:'z in? I H M _ __ _ IIi;,I‘.':I1_‘t‘E'.l'B§-' -;.;I'.' .‘.‘ '- -I 5' .§.-: ' masts o~1uaz E - Lian :-1a:u1'n1:u:..v:smu' rgussrzngnt fi._ .<.- .._. . ..I,-“'‘:',.- “H. ============================================= ./texts/FBIZodiac4/126.txt ======= __ £furiéri_'ti'_nEa1§EsrEa' TD cnfin%._;z‘§iEn'}‘i-:aé1'3ii;if~}f'br-* 'raE_afl1%é11ué='E1i:‘ _To F'[J1_HlISE-I THIS IZIFFICE urn: I-lM*5E2‘.' "Min sERL1L- NUt'$]fH_5'flF FEFESIZJHE * .' -:REUEI'-VINE CEYPIOERfiPH'Ir IHfllN.I% _Q'IIRIHE. THE F,EL,E1'.TE|'EH'IYl"IU'E-_.‘['E_fi.RS, inf" n3$.'E}i 1£Jf§;: n*r’.%§“='ti:‘ ié -. 1ai_t~"-ii? fi'xa§iéi'iv 'éu§:~'-‘éE""' " r _.-_.-._._,._ _ '4-"_-EE.-.i=*-'= *5.-'1 *-.'- . '.- n_sIL'r_t_ T!-&IlIfiEI._ .=% " '- - nah-;: Py-=§.qcH:m_g;,n_:q.‘ ba- ============================================= ./texts/FBIZodiac4/127.txt ======= G|1"H.-.'i'; "L: ============================================= ./texts/FBIZodiac4/128.txt ======= 1.3:. (an. 1:»-.5-£:‘l!- L. La £5 P. i'._\. FEDEHRL BUREAU OF‘ INVESTIGATION LETENT FENGEHPELENT SECTION WDHK SHEET 35‘-=“F"-"5d= l-23-TE) 10:55 aum. fiBf3a'Brv:E= Nb: 9-2295 _ . PBI3F'E1¢Nn.- g_fi9gll_ ? 2 _- Hxlrceived: l_23_:_,q - mjk - - _ Latent Case Nu: fi__1GU42 __ ,E.11.e.'a'-gr in: H ' - - ~ — — -~ SEC, San Framzi sen ' 3 Examination requested bvr fiddressee . .:L.‘7f"f”5‘ *°..‘.~. 5!‘-_'3. Sacramaexitu (‘fr 93') - - - gouge " W. ~ ECTGRTIEZW i|11_n:_It_o_:_ni reference cummunicauun: T315 1:}-PE ]_,,22_,3'.[} I£"Ei|1ZrE'fi~%: _ r.-.:.‘_._ Namad Bus ctg: ET‘; ark <1 .3 I Er":-r Result Eli examination: E:mm1n.-J-u.-m by: Eyidencg noted 13 . ,;J..z£e..£'.r_*;x:‘ /.23—?aa;e:/Hg; .3 L!" .;..- -V K, _\I:: Examination completed K 93 Dj_|:tut.:_nd_ .2!‘ 47”’ Time D e D g ============================================= ./texts/FBIZodiac4/129.txt ======= ============================================= ./texts/FBIZodiac4/130.txt ======= C.-ra\'¢"=\. _ 3"‘-é.n_ a. =.3;"5é5= S-' ============================================= ./texts/FBIZodiac4/131.txt ======= ms o§}ri::.n4.£." $5.5 011-3; 1 ============================================= ./texts/FBIZodiac4/132.txt ======= 1-3.3_IiE|.I-«'.-|.2|r-B-5-‘3J . .5 \_ J-. FEDERAL, BUREAU OF lH‘.I'ESTIG§.'TICIN LATENT FINGER PRINT SECTION WORK SHEET HF"-'-"'-‘I-"319-“ii 2'5-F0 1fl:"F'_5 a‘m' Reference No: 9-E395 ' PBIE"ELe Np: 9-A9911 - 3? _.- ..; Eeceivgd: E-5--.70 _ J,=1.jk _ _ _ Latent Cu.s_g Na: A_-$19042 - - _- Au: u-‘cu: la; SAC, San Francisco Emnuinuti-an I-:<:ua-stefi bar: Addressee v - I Cuuvtor-,_3~_;:;5;f§.C,..‘3acI:aU1.en'f:.c (9-63) HE: ZODIAC Ex {'0 r I-Er W - '=°:§niI!_qi.1_eEeLe:Ir:2 <2-ommunicq-tiun; Tgleg-_y-Pg 2—.4—?'[} ,_§qEcin1ena: flamed 3 _ WM, 1133- ,,.,'.y.. £o?‘5" F-“W-I11 vi €=~=nm='mt1on= Exccuulnum-n by; ’ Ewidanea noted , _ _ g,,_g£.J £3: .-2-.1’. 7. gs:/ax; :4 5.. - in 4% , W’ J gt: _' mmwrmrfiwxzé .-r Examination completed 9 é id") Dictate-d firm? Data ============================================= ./texts/FBIZodiac4/133.txt ======= ============================================= ./texts/FBIZodiac4/134.txt ======= .-_v:.'... . 3.r::s,:'bn=2.i~s. ============================================= ./texts/FBIZodiac4/135.txt ======= 11_ __ E3:'rnr: §_ H. _'<9-4$9.1_ Ii 'ar‘r'u_‘§_ Fé1_‘___:cu1=:_i¢'_t"'1Eznsitan 1:I1'.rI51I_:m’- §-&§'}a*a'!:'I1j\_§*'¢: T-1-n_ SAH FHAHcI5cd',‘_JAtdfi.iIiH "Ii-LLFT1‘. flF,ufz°!fEcI=Iun. oi-.=.-a.ur:_Eau co EE§:RHnRfi!|“a§EBF ============================================= ./texts/FBIZodiac4/136.txt ======= \\nc3€'u- :-\ 5.- tia- H,/ . §j;mI:I. !g2:=.i 1:- _., ============================================= ./texts/FBIZodiac4/137.txt ======= I (Type El: pininrgpr qF'_¢\'j-fig} xr» ', 'AIF.'1'E1.'- ' M5 ' --AIR‘H_-AIL - -' == m ' - - ' n:_n.=:a:-rn3z,_ PEI ':(9-it-9911}: : 34¢; _'S}_a.ii-l='.:fil.|B.ii"C!i_§_I'.‘_.I£|: ' ' H" ' Ex'rn1:rI':+i;' ‘:00:-gfifiprangnto-_; -;dat£ of'birth Ii:Ea';.e'.-::t'ed i H. 15.1?-‘fie i ’>C%;L—Bufieiiifl{ ' 1 - o "H Snerlaehto tfiufisi - '2 - Sm ‘Francisca- I ;:i>"{.r§fi-.'/1_./In/H 93¢. -;.;,. 9 - - ? Juqeul in Ch Sm M PM _ ._m_w..M..;_,_._. ============================================= ./texts/FBIZodiac4/138.txt ======= ============================================= ./texts/FBIZodiac4/139.txt ======= Hfihteg HE .=a.w.1La_13_Ls- 1_~‘Ir_+G:1_z§P L|ET‘1I._1'-TED. :5": TH 13".:-"Jn'9."-I"IE§L"." - g§rE_EnLv nu‘ r%é‘,:_.::a_c";=§cir;+ j3.L1§:;+d_Ea}:'22"§'_-'«_ m'E:ii'i-v&1ao' .- _ _ -' _.- ============================================= ./texts/FBIZodiac4/140.txt ======= ============================================= ./texts/FBIZodiac4/141.txt ======= arcnao :1-1.196} . -. .1 X33553 FEIJEHJIL BUllIEJ!I.lJ‘ GE‘ MVESHGATIUN FOIPA I-'E[.El.'ED PAGE HON SEEFI Pagefsj I=IIi‘I111.‘uII!:|c1aI1IiI'Iz«I=:-' al flIJ'.s1IJ-I.'a1iu:II:L i.I'.Ld:Ie :fiJe.I:3I1:Le at more crfttes 13uLlnwiIJg=I:rhe:Iue:nm, when: mama axplain I311: dr:1I=I:'LIm. I3 Daleiimas went made pursuant to 11:: eazmapfiaus indicxbead beiaw with no segnegable maazxial "available for relcase to 3.rI:AI. 1: (Is:-:1: . U Iztumcm 1: {mm 1: rt»:-{:2} u -IIhJ('i'}IIB} :3 may I: may . I:I {UJUHCJ I:I n::u:1:I In (times; a cI::u:2I ca rcwm-:33 I:I acne} E -:Ir.‘smr:I=:» _I:I 'IJ:J(='3 Er {Ir-J|:4) I: mum I:I rm; :1 (bits) -2: can»: :3 mm} D Wlffi} E! (X???) El I1,'LfCIl.‘D1aIi.O'I] Im:-113' 11:! 3. d:ILrId pa.I:Il;-' 1a‘i.fi:I. no mfiqcucc to that subject of you request 0-: H13 stlhjeucx. qfyoux mqL=<:st 1'5 [Salad i.1:I Itu: title 01113.’. El Documeais 0 with anatber Govarqmmat a.gm1c_-(ties). Thasa «in:-Isamomtts, were rr2t'e-m_d to lhai agqncyfinsj for :Ic:I.Iic:I.v3:I.cl -dLrI:\c; response to you. Pagers oonwjn i.1J.fivnrua2-Imu mmsma bgrazuntlm Gumumcnt agcng.-tics}. Ycru w-flibc a.d1'i.aoIi by um R135 to we mleasabiuty oF1!a.1'.s information foilowmgmnmmufwnw M111 the mm agcuI:_vI{ica;I. Page-[SJ w'L1.‘r|,1aa£d i:|as:1:|1.u:h as a fi.naltIea]ease fl n has not been made. ‘rm: ‘N-HEB: antvisai as to the disposition a1 a later dam. 51- F‘-3.31:. wcm nul. -auualdcrcd fimrcimsn as may axctiupljualivcnf {IL §§"'H|"’ {DJ-. ,3; ,;L Pagrisj wi1JI.‘rI-ald Erzrr the Fniiawimgreannnxsj; E25 The followlng numhatr is to be used for safe-:-aunt Ir-2gardJng. films pagts-. "~»~9~'—"*"*"fl "“* xmai 3{}DCXLX§F;i}{}II_3€X.KX.>C ' ' :-HTJDCU ============================================= ./texts/FBIZodiac4/142.txt ======= I'= E1 ' Um-2;, 1,13-::_:;?o _ £73-P-r -|'JI gf-n='R-I-5:1’-: or #56:} - ---AIR" I-J'.§.E1.. rP.u'ar:'a;r) _ L:m:<:_a:or:,L' FE-I (9a¢sr?11»} __ - _ .. . . Ii Atpantion Identifih-atiun-Divisipn. T_..e_1te:}1;_; ~ - ,. -Eing'-=.-:print- S_ecti'isn;~' .1.atentg_ca" .';1o;::«x.2)_ ' " '- ' '- ua _. __ . - -. _ . ' ' If‘- -m..: * “'5 "“E‘~;::g;f.~’-“'31:; hoping , ' ' _. - .1*%3tLt5*_=*-*“'¥??* ' be cm_npared'wi t .'L1]2t3.EI en 1 e _ ‘I 'pi:'evi o'1JsI;,r_.. developeti - in‘-'ti1:Z sf" da 534: __ En;hris'éd t1-1:-it_ ;._-e.-ars__s::sm'g re'éemb'11enc_ie to the a‘: 1 1; .9 raving prepare é Sa,1:i_E'rar1:1J'.Sco " ' PoliCE_Depa.rtme.I1t. -- H ._-.. -, -'..- ' -'-_ ‘ _. _' ,_1.. __ _=__= _. _. .- ' - -Sal-1_-1vr_;.n_c_isuo 'reguJg;s=.s';-£.-I.th1s1'c':3m;par1'éoh._'. ~ ~ -- L 1-"4 3511- F::\a.r1ei.'s|:3' - 2' »- '$::'a}'1f:ent-E-é-if-‘"3-"' ' aP9.W"' ‘ -'_ The "-3Es.1;:£-I=_-' °a.u should advigé-ho 5ac‘,i','*a-1]'LE_:-'Lt;§;‘:::?-g1?__:fI_ ,. Special Agent in Change ============================================= ./texts/FBIZodiac4/143.txt ======= ============================================= ./texts/FBIZodiac4/144.txt ======= l-da -iasev. El-E-E-3| .l_’. . 1- r FEDERAL, BUREAU OF DUVESTIGATIDN LATENT FINGEHFRENT SECTION HOHK SHEET Rewarded: 2-5-79 11:15 51,111, fiafereucs No: 9-53 ' F'BIFi14- No: 9-4991‘; ' .» /63- §_.c[E.ent Case No: _,,-'L—1lf,'Il:}<£2 _:. ..-_ Hal:-3:'v3d.: 2-5:-’FU .rem. - -'1-1"=BWE'l'10= SAC, Sachémentd '_ J _ H Em ll:|1n:‘J'ti¢E'L refines led by: ,&d :1 11255 e E fl_I!2<:metc.: 5A:I:,- San Franciagco (‘ff - ??~1f.‘r¢;) :utr_:_'_-_ _ _I_‘ H I . .'..wPI_ATf-‘_ '”-' '.-'?_;K{‘-5r- .W"'* Date oi ==.IE-arena:-e -:orI1mun'iI:u:tiun: Airtel, 1,-"3¢.'.|,»"’.H'.:I . --SIts_n_=_i1e1§_Igs: - - -""'“‘ Named fiuspectf _. _ I fl__ ' FBI ;«?:’§__'?: . lfllesult I-DI examinnilion: -. E::::IRi::;j.$l:;'.'h?‘ ‘f,rfj‘“?*=5d'(:,-§I,Jff‘eI£x1.?-1:l,,;;_.:.){,,1_,g_,.;— ,»__.’_'.r:_(..,,-(i./{5{;—a ¢E-€‘*-’-'|-C- /In.-u-«_?’_ 51¢’ rs‘ {- '. ( ' 1-," {F . 7%.: J J - (:3 W _,5 Emruinution coznnlei-ad ..4‘7........._’ 55/614 9 X! ya D-tcr.c:t¢d 51 19% \ iI=I-E Date Date ============================================= ./texts/FBIZodiac4/145.txt ======= ; .DIREC'1"EIR, PEI (£—ua9_L1J _ ' . "'["°t5I'.'I'.;1=.'_.' .P3?_'._L’¥§.!3‘§‘T'5!135:?—.s'- ' éJ’_L12';'.1:=B:.fl3fi‘.£!ISr-3D"'.4$9 :.é2,aa—)j( p_)___ . II‘:-'a.nci'm:n~ _a'lir~t.=_-1 t'a:Bu1~aau,_ .-'. a-'.~' '-"- .-;".-' ._ --z-—- - - s'ed"-p1mt£:'_'édp'3a n'?a_s;£urn'ia=hed by "ii-1 eat: Enméqide -13I_e1:a.i1,:: San‘ -'§'1¢«-.5511}.-;_3‘_gi4‘_~;c;;_;_. ' '_-;_,_»S"E_:~;°°' _, ._ _ 2.1.?u.;"1'ana-~.n.;-;gaquearaua..'t1m_;=;, -91:: 3' ' _ _ itw tha flpecimzna attfiibiifcad 1:c:_'u.n3u.h"‘t]:fis"na,tt_:r.-,:r . %1:_§f=_E5'.*'.__i'B 1'-aquest-éd _1::> adv s_e if'1:11a ' ‘ ' ' ' ' n.9i:'e. - ““ — “' '_ Hammer '_.. FEB 3 T1930 uma;- " 5J}eCi<=1 J'-kgept in Changing a—..-._—v—.-..-Tv—-..u—-u-u——..—«.-\.:-u_—vav,,:,.:__—.gr_,7__e ============================================= ./texts/FBIZodiac4/146.txt ======= .t_r.fii,.:e§7fi' “mi ’‘‘° F rand-Wgf yr? _e _ .-="‘-‘-{'3'-T 3!-.‘‘L'3 _a __5.j._'.I11‘!'." E 314 -1%fi+.I‘,ai='~..¢ ============================================= ./texts/FBIZodiac4/147.txt ======= ============================================= ./texts/FBIZodiac4/148.txt ======= ============================================= ./texts/FBIZodiac4/149.txt ======= ============================================= ./texts/FBIZodiac4/150.txt ======= - _ (Type 3.? plafmtggia: :.od'e}_ , ('9 L'4_99_{1 J ' "’i; xmnn r:A1_:Itm..131v1s1I:u1 .H.I:|_e:I.t in Charge _ . . ' 2.-. '4 ============================================= ./texts/FBIZodiac4/151.txt ======= vagcfgaara .1-.-. -r‘-* ‘ ‘T ============================================= ./texts/FBIZodiac4/152.txt ======= ============================================= ./texts/FBIZodiac4/153.txt ======= .3U_|iE._l!.ll, OF IH ,_ i.-r._:'.g__:11' c.'__' 2_I:_I53'J' - - ;1.~.._ F!‘-E"~7"<'Fj""‘5°d3 3'20-70 re‘ ._- Latent Case No: J4.-lflfl-512 -"'“3“’E”"-‘ SAC, Sacramento Exnminu-tjon naqusated hr: fiddressaa _ Cnwtoz. __ _ ’ -HE: - manic‘ ' ---- ‘ ' E1'l'I3R'l'1'E|H _ Eli isfsrsnce communication: .|!.i1‘EE1, 23171379 fipecifiiuz —¢-.. finned fiuapa I: t: ,,_e,.,;_;.?' . 1,,»-.-<.« #70 FLe31t1tJ of eatcrminntinn: 13:?-h FM_L,_/y_7aM4fi/5;fl,:, :I1n-J=-I?:- bqufligfig W“ ‘ Wad" <:.w§15..»/¢i«éi.~/6/;4.- /.4; :2 24 /z/ Jr’ Q-’H*-'*"n..-r'.m..<--we-- !""}’- 929:1) Ezcurninulfcln camplnglgd ? rifle: :37 $.31‘-4'-d.?':; :m=.~ ate ============================================= ./texts/FBIZodiac4/155.txt ======= ILFU-1-E IFIQU. 5- 2-2-s-1| $3.5 - -I ' Ej<:|-i-'e:' ...- {T)‘P$ in pine‘-|:_or_x: .2: -5 aisléiia,“ am. _ir[1-, E211 - -DIRE£Tn£,_FBI {9§u§9i1) .-3 __ ’-Hz nxhc” ,F_ ’r'9 »-*- "EXTBRTIDH -. 0O:'Sacrgmento Insfiectar ocatefi 1n- _ report -- .-»;r1y En ,fingefiprlnt=‘$u§mitf --n- :Ffian¢ificq ce Depar fipgativg rasultsflg .::¢#?Fs ::vEfi$1rI9AT:¢fi c}_s§y Fflhflfllficanfig-22§§xf1; Fofizxfiffirmaéianflof-th _EfirBauL _ gdvised;tn in#$htightia§ hx: _n;fIsIpN}_ Z:.*" "Jails.-a.G |3:lh¥:a11'_._ Mr. GcrnL'ad.._._. HI: G-nl:.'__T Hi. Ewen; 11:. S|.L'|lira;rI'_,,_,'.w._, fir. Taw.-cL'_,,_._,.,_,._ _ _ fin $o._I-'ars,;_' ' ' '3I'¢iIc.- Roam; Biias Hulrue-5.: -2: Lsao-Puliq ar n Q adi " ' «195E1}??? jfin gun and Sacrfiflentog ============================================= ./texts/FBIZodiac4/156.txt ======= ;:_t»‘,P¢Q'!‘,‘I'O" = ’~_ 3".:'_ll1|lEi>l'I_I‘l‘__'.'.'!lT| . -. L'n=__I r~:'_H_‘r"FIr§_1a:_t: H"I= Elia ' ‘T-:§l:_'%_E[ _FlEE Na. iF'§J'§II,.I: ma. ============================================= ./texts/FBIZodiac4/157.txt ======= 3.35 :1: on.‘ 1I.-s-.=:I’:- ___r—». , ’ ’ e-if ’ §— ” FEDERAL. sum-2.-s_.u cu? INVESTIGATION ~ LATENT ?1NaE1=:?am='r sgcmgu 1-:oar< SHEET Fl»;-écu_-dz-d_: 2‘.-2-{J-?I2I 9:20 am. Refers,“ Na, 9-2295 _ ' FE!-I me He: 94.9911 .952; Renewed: 2-ED-,'r{J mjk - Latent case Nu: 3.19942 '‘’‘"5'".“ t”; SAC, '3._.n- Frsnitiségfi " . . - . , - - Examination requested by: add:-E3533 C<:I:>rtn.' 3- Sam, Sacramanpo xi‘-F-éi} RE: 'w"--EC;-DIAIE . .._ __ __ _ ' EKTGRTIUN D-A::t-3 of m-is-rezlce 31'1'I|‘gIL;Iuu_i_¢qI;j_qn; Hi It '3 -13 -7'3 ‘."="<_"’ - -3¥s.ea:isIJE::lS,= -' ' If __ Ne-med Suspects. __ WJ ._¢ -' ‘av?- jc» ma W-3 . ' - 2? NJ‘ 11» Der» 19 - ' . - mm, 1303- -c;:u;1ae1=é,- 1:.‘ i W’ HEBUU 05 examination: Examination Ly: Evidence noted! 1:: HM’; F¢.fiE(2s=} P ;; ' __ ~ ‘IN! , R-FI’.r_'.r$-etlz. I3s‘£..gInq_,’_Jfi',__n.-£_ u_uI:_n__urE__ _ .u,0+ le?N,,fif:_‘h__! Ferry. .-H-we ‘BI.-'5J'fi""—’r;3 . £fl% _me,-’ 6:‘: a='mr. 'R=D.v‘°'ar£-:"'flr fléarfe’ !~'s-9+“-‘*="“ »‘»'-sr°"=**‘«fi-U: Fe-W3 I mm H’ fin!’-"j_ I-ti-j -';p;.1n,;- _;3j,_,A;_g5- .,¢_ fg:-“J 'A‘;fc%§J_J?_Hi Far 2 H E nomination com plated .u'2_'3c- Pan 3-2» 7:3: Blamed 3 —.:I- 79 hag ,_g Time 1;-=e_g‘T jg: 5! ._.\-_j ============================================= ./texts/FBIZodiac4/158.txt ======= e _ _l—3:I5 rn -iv. .L-2-1 0.3:"? . 3% #2- Faunanu L- or _'i:-In-v_h\'.'\;%G_-h'_.110-H 1 . ‘§'.'<:Isl;m.g.tn:I;1.. D. C." 2I:I5::.'_i' __ ‘31=.=' vmzqn fig ============================================= ./texts/FBIZodiac4/159.txt ======= L-3|: Ifigv, 1L-G-E3| . ": r :3. . H I FEDEH.-KL EUFIE.-UJ UP INVESTIGATION _LAT'EN"J' FWGEHPHEIT SECTION WORK SHEET Flecordefl; 5' --"" -‘O 9 ;d-7-C’ 7'" -fin Reference Hm 9-2"???‘ . FE] File No: 9'-r.';~5*911_-..;,;_-,1!‘-Jr .- - H§CEi'\-'-ed: E - Ii :_ Latent Case No;A_ Answer-La: S.5“:.iE.’_i._..Sg|;';_]E:-;:g‘§|3_|:j_é.;,:}‘ 'l_ - - —. _ Elan rninaii-'.u:I raquestea hr: add;-egsee '- n cantpl-at-ad Tfii»; - 2' -1 ' {),;.;t.;._-|;ed - 13:5‘ 5" Date D 9 M Result of examination: Exgminfltigu by; _ Evidence HM-ad by ~. ;: " :":_ '*“'_ . "‘-'— ----- -—v—— -H--~-rvwwv-—v-mm-—-—-—..—u-.—v—.n.-._..~_._..— -m_.,:__.__..,_. .... _,j_..._,:_ ._j_......_......,_.,_.._._.._,,,_.,_..._.__.. ============================================= ./texts/FBIZodiac4/164.txt ======= 4- _:' _ I‘ _:' s:>_-g§,,r_§_a1,-5.32.51] - -o ' --'9: . ., ~ ;-r > ...._ P‘- {£1 -F B-I‘ Dam: u?21;?u {Type In plain-I=l:::I 1'h|' : ._ J . . . . _ _ - - -£LIRH!;.IL_-"- rrm:-it-_u1 nI£Ec$uR, re: :9—aa911; h_§a$TEH?leH;fl3f31'LaaJ _. 333" saw rn§g1§co'fi§LE§§6J (#3 _ _‘- 3: ‘_- =-6':~;- _:' 9- ZGDIACI Ei{'I'_DF-T_I.C|H _ _ ‘ 00$‘ Sa::r~a_m&::n.'c - -' _i"g§_ég£ Fbau:ignq:aiE£e§ ugzdrfin. '..-§-:- - ._ Encl-used for tha Lab is one bhntu cupy éild oné 331}; ¢f_,1:wu. page lettar and envelop; wh.'i.a.‘1- envalafpér ‘a:'=Ietn;1dx~eaéted_1:o' Edi'i:_nr-; San Fran. {Ehr-aa'.ii+:~.le-, San‘;-E‘rf_anr.ii_§:i:a_ '_E!a,1ifa-3:'Ia:i_'i_a_, and postmarked Francisco, tlalifor-ni1a,"inf'2!2If.'J'I:l _; £13153‘ éllfi-1-r£y_ _ _ _ _ _a.me_ Bgreau e.1_1c_f33$ui.*'1!L - ' ' - Far the info!-matian _n.f...I-Eah'a.m':| 'Eau:::t:'a.ni£nt - ' clo us:-as wan fur-uizhad #.F.'21.LT.u..hg;..Inspan1a ._.——.E>. Hunicide. Retail, San I-‘x-anaiscq PD. 'In51:I-e em‘-.« -' dviaecl fl1.flt the latter wés raeeived a..:n. :::_r'_ :.r Ea.nuPranv::is {Ihra "ale and furnished ‘ED ' _Sa.n‘i_P1_‘am:iEri:v¢.F'D. ,_._A . -.= . - .- @- Bureau Iiennsi-' ._;__:EaI:az'a.nen't¢ (_E-tI,l;-'- ~ _ [*3-"'Sa:n‘_= P-_éa1nci:='-:_p “*"_ cgfhbg.-_...'_ ' .' ' "SH. ' IE)" '- "' énpumved: _ ulcfigx-|=_-I:I-ul Agant in Charge --_..._7,_.'~_._'_.-,_.. _ . _ ============================================= ./texts/FBIZodiac4/165.txt ======= J=.=5£*W15!=¢=i" . 3-E:¥$:&§¥‘ai ============================================= ./texts/FBIZodiac4/166.txt ======= ============================================= ./texts/FBIZodiac4/167.txt ======= -|'.‘lE'C.-‘Hill {E1-3-96) ' -. : X KXXXKX FEDERAL BUREAU {IF ]I'~H-"EST'IGA'I'ION FIIIIPA DELETED PAGE lI|"lFOEJ.'\‘1i'LT'[0N -SHEET 3* Pagflis) wixhhcld entirely at lhis |u:n:.a1'§cm in flu: filr.. flu: or more ufflm fullu-wing smmzaags, where injjgawdl explain this d.eIe:'u‘:u. /H Deletiunsweremaaiepumllantwlhedxnnmliom indisaxaclbelowwtflzmaqg-egahlemaletlal an-ailablsfor release to rcru. _ Efaflfl :$l.I;!1.% Cl -:n:Jn:1:: _ :1 gammy El (=1:-m U (52-I9} E1 {H3013} El 1213(2)- El -fbJ{3J D -LWISTDKCJ E1 113(1) if I33}['?]-{D} El cam _ U EHHTJCEJ E! (5:19-I331 _ El ft-J-{“UL’F’5 _|3 M4) El EH4) U {W113}! El t'kJ{5} 2:: (W5) as aw} I: mt-5} D n>:-I:6:- Er scum I:I Inf:-rmmiczl pimain-at only In a mam _=,:=I.rl)- 'vrJ'.d1|1cI refetmuoe In the mrbjact flfjmn rcqunst 0: mg subject .;5,,-W :rI\:|q_=.u'_Fl: islistcd. in um am only. El Bowman o=1‘gi.uan-.~:1 with anuuner Guvwmmmt agem:-_-.rfiesJ, Ibesc r1ncuman1x -:5-am :afe;m_d to um agcncyfiics} for revl-aw and. direct. rflptunsr: W ycru. Pages contain i:1fc-mafinzrq fumishnd hraucrlher Gm-ammmt a;genc:,-cits). You willha 3:1»-ism by :11: 1:3: as t-:- the r»=I~=asaJ;-iL'n3.r or 1.11.1‘: mfmmatlcm fcliuwbag Um consultation wisth me any agmqfifi}. P=.5:er=J withbeid hzasmuch as a finflxelwee determination has not new made. ‘Ecru wiJJI:-c afirisod as. to 15.1: dis;-Miriam a1 a late: dam. Pagas Willa will Dam-idntrbd Fur release as may are dupllcative of P3399} ‘W-TUnbn'J.d. for the follawing mas-:~n[a): J31: The hliundugnumber L510 be u.se:c1 far IIEF-.*n:noc regarding tJ1s-.33 page-3: ‘iv e~.-qu- ya ;.::--:;..4 ifs-'_ i KXR K PST Dclutod 'Page.(s)n X K N-0 Duplifiatfiuu Fa: K 3:". for |2hL5- page X r#QXKK KKI'5C KXKXXX XKIHKX KKKKKE !=l?|.-‘D0-_l ============================================= ./texts/FBIZodiac4/168.txt ======= .'\'_‘5'fAé E’-L‘ ‘fI"i.r' "F :,,.. ============================================= ./texts/FBIZodiac4/169.txt ======= . . - _ :It:.a»_gIa_IcI:_I:a.'.g-cngltsg: , -' r=n:ah_L,'= 9F.,_.H.v£snfig,« - "II; F. - E :mu'|:I ============================================= ./texts/FBIZodiac4/170.txt ======= ' '-1' --.- |_fl':’:,:|pq'|_q.r:f 'I_':|':rI:=L|.Ib:I] Farm T_ __ . . _‘__.I _ Q; n u-nn_.'_r9~_nI* _-‘fix_-. ri=i=:n.A.f-i.:i‘iTrsa'u fir". 'Tfuvrs*nr.:§ _ ‘ 3i'_l.sI|rlII_:_ljnH,'-_ IL‘.'_C. ” :as_:'s ============================================= ./texts/FBIZodiac4/171.txt ======= ============================================= ./texts/FBIZodiac4/172.txt ======= ' M ' __':‘-g 7.1%. mi}? "-‘.3’-" , Ilflilnn FECIER.-KL. BUREAU |2IF]Nh’EST'I-GP1?[CIN ‘ '.-p‘1Q"fl UNITED snags DEF‘:-.Fl":‘1{E£-JT OF‘ JUSTICE Luhumaur-.4 Ticurlc Sheet I LIE fill Fl-3: Iaug _‘ File-at 3.,{”;1——-.'r;I;E"" _ -- _In';m.-Ia: , Lab-~23 I-7§9|;M¢u 51,-- flfi: - In::-nmnin- ' ' E"°'““‘““‘."""'“"““‘*““°"‘ Ian mum (‘I-Ilfil mm using _ EXIT-1'-'I2I.2i.||.CEi2i.C||'l-[_%_E:%.|.1‘E'3,'5§‘:"! - - Date :er:-at-:-ed: Flfi’$‘I_i1l_ ¢.E_E:if.|'-||EI1iFL'Cl1.1ElF|-:- E J Exuminutiori by; = - ' L éa*:'c~ _ -' 75)!“ I-ts-‘i/(F?/'-—-.5’-x 4- _.-' fr-/F ‘ff ww{@% %* ’%W '*--..- /é a.;vf,’,M,,w.1Z.-=7¢gz~m f,a'!-‘T"|-PTfi;"l-*\.- .3] :‘_";‘+r='*—’''5T 44"? Suecimne submitted for é:-mminu {ion W" - "Ia .eg_u_._:'.* £ 'i‘t.1.r!.r'I.:'rnu!-Ir: - " laumh‘ rrintll E .-- 99‘ Ii;II.Il'IIlit'El - flan» «nun mung. £;5I'ua:i¢3»i' _ ============================================= ./texts/FBIZodiac4/173.txt ======= - Tfunsmit Hut following in -: I‘ sdrHw.-snzaiim § "*°I"' ‘r Dqte: I+.f 2 ‘if ',?_1] ’ {Type In pIn:'I:le,-rl 47 wde} unfit __ ' ' AIRHAIL 1:1 nficrldk ’:»:n1- {El-'-"IQ;-§I1.‘1-3-"-"I - I -. ".4! attent an;-__E§I___ Laharatnry}. _-Ry a. I-"E11c1§Ia'h;:1""for_I.phVazva_§;-an: I2} X.-Ei'@:|l_'l._EflpiE:8 -&'ElI'.'H:--E-rf.'_ _ d&’:M.anad- ta'.Erz'_-.nf-1: Bnar~r5‘-53;,-' Eilxijiia -1a.1::1g,:-.1-:sc:m' -132; , - ' - =1iag?}‘.En:-ax. {_»J..JI._'—:'__-l:y';o_'a_Ln:l~__1e_‘1:_"|uej:'__2._«_«'-_ . '-" ‘ "E on |IJ'J_TJ".FB_=r¢qIHst\_e_ -- _ _ _. 1:39 ¥'BI. Lahifor In1:a.Iimi'.i:ia1'a P ' ?LB.b in neqwII_td1:1 ‘ES-G-flip-l_.l."_l-'_ - :_u'1:_1:u- whi_ch- u¢ra- at:miJauta‘d to -mans, Special Aimnt in Charge .-_\I , \. ' .. . , . . "1='-a"-=?Mh"1't*‘i.1'=i{ ind.-‘trpe u'I."hh_:1:ha’t bf "§1!"'Ev:i.ita‘n3 ap-eciIma___ tibial :1 " -'Ea':'-swings ',- ' '1:h;I. ============================================= ./texts/FBIZodiac4/174.txt ======= ...¢~:_ _ S-1:ue:<:in:1_fi'o:;¢_nt in Charge ============================================= ./texts/FBIZodiac4/175.txt ======= El." _ BUREAU. -OF; .INV..fi§IGfiTIqN; _. I.ira;h;n¢:'on, n._u3. 2053?‘ - ============================================= ./texts/FBIZodiac4/176.txt ======= II-:33 |IF|.e1'- ll-H’); ' _ ' _ 'V'\—‘_ - P? I: -2 3' .9-. ‘W4’ "-w5‘° FEDEFIAL BUREAU OF INUESTIGHTECW LATENT FINGEFPHINT $EIC’I'IC|N WORK SHEET H9CCI'[Y§Bd: 9:30 am Reference Ha: I if . FBI File No: g—1L9-911 Eeceived: 5h"2'3_f‘i"0 d"'!-1" Latent Case No: A.—1'0{]-'-I-2 Ans--reit-:1: SAC: San Franeiece Exn mirgatton requested by: Ad-'-1-1"-i‘-5-5'3'f! Ca;~y'tq:__ Sacramento <’.i?..."5_;‘§ ,. ax-. HE: ' _zo1::I;éc -' EI'.I'GF£|!'I{!N . , .,;_;@_g_t_e at reference cnmmuniccrtinn: ,q_1r*t¢-1, uflfiffo $p-eéfifine-Es: ' 5 kiem» W31 rec Result of emmlmltuun: .~.. .. Examination by: - ‘M,_,_d__,..r"' Evide nee noted by: mm L: W” -; wig Vflxirvvx ,u.,w.-9;:-=-~'*i " 3 " 1l;'*“5"""”' *""*“-=*”5fa g€3‘»f*'€; h =~.-*~r~’.=—A3i'-,1: \-' -”5'~ -F.‘‘“tf’E / -725 } '+-':.~— -: . T .,. . -5? _ 3 J if ..- Elf‘- . _ ; ___ , _F I I 1- = EI'U:fl.'-i|'.|U:U.E||.1 completed _,% L-{I J } Dictclted ‘J 3 L'w"' fl inn? Dcrhe LL ,N_,_a—~ Date 4._¢_5_#_, ============================================= ./texts/FBIZodiac4/177.txt ======= ============================================= ./texts/FBIZodiac4/178.txt ======= . . . ., .‘="=.='1 5u:«_?1:IJ1nat_1v:i::T-s=_'J‘.rI._’__a.I1 -‘effort __ {in 'th'2.'s'3ma1:ti=_-':c- mg" ‘-_3_-°_-M _. ---/ .._ --- .-..-..1>- t‘1'EI'é' 'p1':'ab€11=3 d;'hi3.f 1.11-I5 . ' -w;:‘E%f‘_’- 2. ,_ .'\. ============================================= ./texts/FBIZodiac4/179.txt ======= EVIDENCE FEllIAl.. EUHEAII OF IHVESIIGATION W'fiSIIINE'l'GH.- D. C. ============================================= ./texts/FBIZodiac4/180.txt ======= ¢J1=c.-.,<1u- (12,:-94; ' ' :I;:-c:-;::g,s;:.; FDDCEQIK KXQCEKX FEIJERAL EESEEAU 035' mwgsxmgnow PEI-lI'e'A liFEI..Fl'E]II PAGE mmmmnou SHEET i Paws) Wifllimld mind? ax this Jowcfiun inure fite. Opt at mm: mm; Fuliuwiuugsnasnumua. 'W?J.E.1'E indicaxafi, explain Ibis dilation. Dfilfiiiiiflfl Wfiffi DHIH ];I‘llfl-"|IJ.3J.'I.1 IJJ the emmptkms :i.1;|d.1',|:ated below with pa s1:g|_'|:ga]:|[-c n1a,t<:u',g1 :a_'_.-1-i1ah|3 fig; mam tojou. I3 {Will U {hJ':"-‘film: El {cnqsp El -331:2) I:I -rb;I-:7‘:-f-V3} El -r_'r):;2} U EWE3} El I.’b}'I1'3']-{C} El 023(1) 3'3‘ |:hH.‘"*'J{DJ U (‘-:}m U {t'J{’3'3L’E}' E! UWJIZSJ '3 fb:":??t'P’J _EI ml:-=} U -:t-3::-9 u {WIS} :3 cats} El (b){5J I3 :::>;-{9} I: gm.-,1 U 833(6) 1:: (ax?) EF Ijsfiurmation Uulyto afltixd party \5‘i.UJflDf€5€:‘E:J,Dc 1:3 lbcsubjgcl: qfyuurggqug-g at we subjai Of).-1;.-IE request is 1?.-stzé in ma title may. ' 13 Do¢I3.:1:u:-uLs o1'igi.|:Ia.U::d. I'iLhs.|:H:rLh=m.' Govtrumomx a5Ir:I:I.cyI[ifi]. 'Ih%-3 d.u-cuuyauta wax: r¢fi:]_1'-ad on ma; ;g_g_¢_-g;._-;_y{i_¢3j fDl' r2’:!-'52’!-'=' and dilad. mipuusc to you. ' Pages Domain in-‘olmfiion fdmizabed iayanuthsr G Examinuiion requested by: fiddresgee Copy to.’ --. .zGDI_aG 2 . .;__. EKTCJHTIOH - But? GE reference zcarnrnunicution: -55-1'tE1 4- 5r'"7.-"70 .. ~e‘.;;‘;;-_éigi_g.-ans: . -a__.F:_h - . _ Name-i ELI.spects:- _ _ "Kn" - . / 51¢ ' . Result of Exumémtiun: Examination W: E-.-ids:-ace noted by: L:-1:‘ me; . .- -_' ..-..-x-=.-'.'_u.. -" ‘ a - --' 'v‘\-E '- z- jg-{ . . I . ._ ~.__ Emmincttlan comp-1-§-I:-ed, tfl1 , Q 1-517 inne- Daze ============================================= ./texts/FBIZodiac4/190.txt ======= . ‘d-LN . 1-as La“. U-5-B-I-J Q ,8‘ ‘Q FED-EH-'5.L BUREAU OF IN‘-FESTIG-5-TIUN LATER? FINGEIHPHJNT SECTION WORK SHEET Heccndedz 5-11--'70 3:3 :05 P.-111 . Reference No: 9-3333 FBIFHQ No: 94-43311 6 5 . Received: 5-J-.l—7U J'.'E.'[0 Latent Case No; .:°:—10U-12 Answer to: SAC , F.I'EH1C‘-' 5.3-!‘-‘-' '- . ._ _ . _ - , Examination requested by: "a*ddrE‘35E‘lE ' . ' lr_:c-p-,r_I_:_c:f_ j,.I5IrL§.a.y».{,4.'r<: »::!'..-1,; ' - 3-‘pociul Hand In Cfinrqvz ============================================= ./texts/FBIZodiac4/198.txt ======= ============================================= ./texts/FBIZodiac4/199.txt ======= ============================================= ./texts/FBIZodiac4/200.txt ======= H , _t3:;. _ _ I_iJé.':fl_l’-e'§l«Els_=.3_a_e_ u51t-Ifa'c:i'_1’E"'-3é«11:'ff.a'TL' St‘ Lguia as_réf1e;cta':Lb{—11ow ;~ ' ' ' ' ============================================= ./texts/FBIZodiac4/201.txt ======= 8'='1-‘r_H:‘L‘:':-;_ ?se'h'r;-ini a'1-1r1"_‘a' 5'33’-5:3-”’i .3-.1 t'§'1'-“'- ' 39,;-'.‘-’fl:". :5, fi§E"‘““‘-§§§’; hL‘i¢ ...'5I5*~5'3§‘.,~‘-‘]";‘?‘~=§‘E:§***°}"r»4§‘3’;“=. . " a r'I'c' _ z = fib ============================================= ./texts/FBIZodiac4/202.txt ======= ============================================= ./texts/FBIZodiac4/203.txt ======= ============================================= ./texts/FBIZodiac4/204.txt ======= 4-22 |I'‘|--'.~r- I-2:!-soil ' 4 1FEN§Et'EtJ H-|k£~'='r-‘II5 U-E Inva-stt<:In:t_tiozI. '3. Hazard; Sm net: WE} I: Name Seurehinq Unit — Roam. E52’.-‘ _ __ EIS-grr'u:~e Linn - How:-m 55’!-t _ Forward to File Review . :|2'm no Tvgsce oi E91 eel-=-as Ftlruu-esiedr — » E uI.L]Gr fieuue-st Uknuivtlcul Search] _.i;1L_]_=t.g§¢re1;c-is [_$u.twia;'3i'.r2- :5 Nonsuhv-er-5§\*e]| $I.th-4-'$::$§,_*.I'E l_=tva_-Ee?Ie~_},1n';«a-5 Only _ Nansubk-«azrsiw-2 Retérerwes U-:I.1';' Maia R~=I§.s:etIbt’ICBa& G-ugly 'T'w_-p-e of Search Requested: Restricted to Locality at I: Exact Name Uni? {On the E055! Ijam-Lang Variations $u.i:j-act EI§1t|:1dc.te- (ix Piece -:h1riD9$8 Luculitiifi Search-at fiat Date LE; initials Prod. FILE N UMBER SEHML F2 - M E’ aa:.;'_i.. ' " .».~1,>.-.-'.‘é$-*é"»'.‘5.' ============================================= ./texts/FBIZodiac4/205.txt ======= ukmu-. or nu» 5§t|%og_11_ou' .% '-'!n:r-shixlgtolrfr _E}- 'C_._ ' 2'§|53TIj mo - L -|. . Hf “E :-c':-?"-- F-""3 '- zflewpia linu- ============================================= ./texts/FBIZodiac4/206.txt ======= €22?" - ' TRUE COPY “mi J C» . '9"? {gas ’IE413,rf"r’f — flE.a:{3"3h§5’_-. _ - .... __ _ - __ _” L ‘ I I would like some ininrmatidn on the "ZOdiE.E§ Killer. " And ii I115. real 112.1112 and b1'.rt]1 date is lmown. Could j."t:rLt also send sL'::';:nethj_n,g about where and wh-En he: killed or more iniormafiun, if puasible. "' ' I __ " Could you also send an autograph and finger print "'“' of J. Edgy: Hnarer, ‘—:_-— § -P1937 _ TRUE COPY * FWxfi< : ============================================= ./texts/FBIZodiac4/207.txt ======= , Q . z‘-Ev-7'. - - ’e.om%EsqUr:rr-s9ENfiE -.-M.-jj.,__,:.-_.__....v-..~..w«.~..n-up-..,?,,;,,_D‘,z.#:_,_,,jF ============================================= ./texts/FBIZodiac4/208.txt ======= ============================================= ./texts/FBIZodiac4/209.txt ======= ============================================= ./texts/FBIZodiac4/210.txt ======= -a ============================================= ./texts/FBIZodiac4/211.txt ======= J_-£I_?|=. ER": '|\£.n-r1__*- ' .'\-‘C ============================================= ./texts/FBIZodiac4/212.txt ======= _:-a»; |'nq::. n.s.5a| . ‘~_ ""3, +1-_'-_._ ...-1. _ PEQEHAL BUREFRU D]-" T.N'VEETIG:*5;TIC|N ' ' LATENT FINGER PRINT SE-CT'[|':‘lN_ WORK SHE ET H-klimdedi 6:11;?” I'D“-m '9 -23- Ftefiwezl-:2 No; 9432951 F'B1F'i]e- Nu: 9-49911 -rfai 5 HE(N'-'l"E . _. -. ._ :._. ============================================= ./texts/FBIZodiac4/213.txt ======= ..._.,_. _ ============================================= ./texts/FBIZodiac4/214.txt ======= gnjr-'. .*h:;-°:' 3'.‘ '\. .2 ============================================= ./texts/FBIZodiac4/215.txt ======= ============================================= ./texts/FBIZodiac4/216.txt ======= ============================================= ./texts/FBIZodiac4/217.txt ======= ============================================= ./texts/FBIZodiac4/218.txt ======= m." - ...:--.;_cannect"1c»n ' w_;.th thggodguu ‘tiller. Sc what. I__:1:=u'c>_a1I:1_:}_i]-ze to do 13 ::'eJ.a1_=e"tftt1s in: _ -u .d_. ffiivnatjon IEI'EL-13-§I<_I-'.'lI|1 so I can ?,tni:‘l :2-lut--'1.:r':'E1e_ is informatimn. i_.n}1_'ir so.- '4»- '_ Therm are three names thafi have pa1"t1l-hill-Q-1‘ :_.n¥.i:e§.'3a.' .':-'11:-_'_' I— anal- an at .._I§?:Ii,I1_t|1g.3:I1_nL;5gl:~u__sI.1e11.eI:1 h...1}tt1g <11 ' 1 _1_;a'n here. I thin}: that :1I_a:_rb.e a Mr." -.’['na.a,t wvjeaawa fie ma It may, '.!1-.'5_fli1'e]:';. be-. or —et£s. 'O'Eit':|n:2:,_i:1f'c:rr::a;ti.::rn that I have raciereli has same in the form of .171’?!-' ' '{:'.<':a'E\£-_JE§;'{E*.'£<':'~£:. For uxampl.-., a ¢&a{:r13:'tian'o’f'mfii,'1'1:a£¥E1'bugieg. ifiiun 1' 'g;~'i'='tf.;}¢1¢: m':1;':',1a1:¢a by ma.‘ zoinaa. i nice thLnJ:"tna'; ¢¢ri-.n1n- ' "Hahn: 2-,'.1n:I.'ct1::_g.p___h:-av: 1-13¢: a Z b1:I.r-net! in their flesh. I-in-5id.e:= being mutilniiecl H -xi-¢_:;_.__una;5§4sE up or aumatn__m:J by an up ltltnifglg or sumnchifizgis of this I Ilsa thin; thatimore than one person has ‘been Bulapeft-sqzecl of I:-art-ioipfttf-111.5 in one 1351;:-:"3i1:1~r'i' Jr the killings because of the war lD'flE|.Bthi-‘BS-'1II-.103-.V'-11?-3-t'1'1' - I kl.-llinge was done, However, I'm nut quite euro-Hhlt it Ills. though it '1 allw think that aamatmug my hair: ha_EIpeneI1'o:r1 {pi-orioun ,Hé+u',.Ee'u:.-ai Eve or day. I also think t.1iat't.he1-u Ii a rllatiunlhip lhetljnln Ii P8I";i=:-u.lflr :J§:i1ling and .1 river. possibly maze punt-.-b;§5’:k1111ng. fi£|-.:1:££-9E;:;;nga tiité) " Q“-‘\:5.\ma.:|r have Hutu connection I-rii:.1::'-:{:h:: Zudd.a-Qua: flfizégeeg E915-I! Van: (110 ‘-19! w. ”\a _......_.... ...._. RI. F‘ 94’ paint the ocean, a»-Volkswagen, and the 1:1-‘itlr 5:1‘ 1"I1.c3.!‘.l1'l'-_I=- E ‘K - Raj I $1.50 believe that the Zodiaé tiller must. be at b:1:'IJ.tl1. Pfiféonp 1101? §11ifl'H%$§fl- the sight of bio-Dd or turn flesh. - cg '. ; -- “"x_ . _}’_/__¢,_:_’_ RRl*3S.P{T'I‘3' . “. ma‘: have-I ssotaething to <11‘;-"7-r5hth hear! UbJec=_t,'£=_." p“/rs» ============================================= ./texts/FBIZodiac4/220.txt ======= .- "*-1"?‘ rb..,,_‘ .r M -.. if‘ . _. E ‘-51” *‘==' “jam I M atfiw-'i===t.1i'=1=-'4 ¢~==1-1"’-»‘=" -' _95D_ih~.. I £é'én prahatiun in San 3D$e,for a Eari;g§§§ offansn, which is thg P‘ "~=!i_1'.r If»-t!_15I' _s31a¢=- '1' mafe gone tafuli-ask mu: _t:ia' 1‘a'E'1§‘+:irm'.»a'=-t.1a:'£i 1 man; git-ark.‘ Silt :I:'1ot_.'11r:a_ saw: 01‘. _1.t_,. _exr.=a-5:13 E201‘. tam: green 3-cndgu Vain. ihlah 3:: 1 N officer El’-lid h¢1.:F$'..: 3; '{".u.+-:-51-:-1.jaI-.1. ============================================= ./texts/FBIZodiac4/223.txt ======= |__,-fig -{Rou_ I [-3.835 . FEDEHAL BUREAU OF‘ INVESTIGATION LATE l‘-ET‘ FINGEFLPRINT EEG TIUN WORK SHE ET am.-dad: 6-3-1-70 10:00-_a.m. Haiersnc-3ND: ~9—21u3' ' _ F'BIF‘i1-as Nu: 9-49911 e‘;L<} . - Received: 5‘*3‘]"-'9' 5.113 F Lc=i~.a_:d Case No: A-$9943 _&L-us-are: Ln: SAC; §t-- LD1J1'1E-W -'- '- - -. _ « .I5d-UTESBEE _ Exu Inincltiun requested by: _ H -'zGIi'1‘;fl.C"' 2 * -mama-rzon r—- » f.'5:=If:r_:rt~=-_=_____.g’-':’.- SAC, E:acr:_auue-nlto [Q-B3) __ '.:.-' __ ' .%|:$ Eli Isfsmnca communication: 51-rtel s‘2E'7fl . U - ' ‘ ','me.m;_: -Named 1‘ arisen urpc-325 £r.E~:- ' ~- I‘ '- -vs.-.. Ls-"W Haeuit of examination: Ezu tfiliflflillfii-£1 1:)”. ’ Evidence :"u'11LE-d by: _. . .51 J’ M Ekflminfitinn completed ============================================= ./texts/FBIZodiac4/224.txt ======= ============================================= ./texts/FBIZodiac4/225.txt ======= ============================================= ./texts/FBIZodiac4/226.txt ======= F_U'-BS rn or_, -5-1:-sn_ egtiqn 1:-1_v. ,1;-. _ 153-fin tgfl 1: ============================================= ./texts/FBIZodiac4/227.txt ======= - ; .- The following "1n'n'm5't1g'a _'1c:':1 w_§»'é.="'§:§unEi'-L1;:-uéd Er é:;i_é§sé1§{1: _- t- 31:. L0!-r_is!. .. .. on-am-2'9,-..."97 ;qvat飢='us_'=_;mam_i;;:'r.&=1an " Raparfla Prucgssingjcantar,tBui;din _43DU'naodfai1oh,_ ; Lnq£§3Ifi1§qpu;1;:naqgg: :11 gl _ " Ii55our12f;”;_ If :59: ..-,:'. ,Dgie oi hifth I ' Flame of birth ._ _J:lIi¥--.-.. —. fisess--' _ . Haigfit “' Height . - _;p1t}xaq_ -- ‘- 1I1,1=;..'='\~_a-1' 1d&rebfio5' ‘I11!-E Itrriuga Ing=;b- "'£arn:t1pn:' ” .-c 5.13:1.-:«S'dFlE -wu....____ -. -----a----—— - ---- -'-'---\.r--- --.--- x--1- .._...__. .___.._._.___ _._,_ _ _v_ H__ _ ____ _ _‘_ ============================================= ./texts/FBIZodiac4/228.txt ======= r“i GAI;§gH" :.‘ .$. -.:"..'1_f,—wa=.¢.»... - . . - ' ; ._.:.-.'.o-- , v T—w—,..=.—‘..v—...°.°__;'.w;,.1,,__,,‘___,_H,,=,_,,.___M ============================================= ./texts/FBIZodiac4/229.txt ======= CECA-Willi-3-9“? - - . i 30::-ncza; L BIREJU OF G$ . FUEL DEIEIEI PAGE fi0N SHEET hf 3.3.19 -n-1':bImId¢nm's:=1}r:::lJ.ia21o«mu:II1' iuafimfita.-Da:armn::nffl1¢£¢lI¢wings=flamnans_whaén:'m=d‘¢ag¢,1 ' fl rdcasc lo 3~=fiI- * _ seadaissz - ' ' -Setting @- ca +:I=J{I3 _ . :3 fillfflfi-‘-} CI (rt!-I-'=?' Et <11‘~.'L‘\?.-'\-'2I.'.‘=.'2vC.3C_‘4'J¢'.'-"\If>(}K'.5i}-2_K ============================================= ./texts/FBIZodiac4/230.txt ======= .- ‘I’:-(-omns C3. LU-|<:H 1-nun:-rr =a:MB|'I~1- CHAIELESPA. CI’E=e-:-:ru . C..N|Yl':|§|1'.|'G.--A"'|E|'l>f’¢¥|.7fi"{ElIA.L Attn: Latent STATE 0 F CALLFDR N] "7'-. 3- IL...-'5 J BUB-HA1-' UF_ GB|i5fJ32"\‘Al.- l'|.'.|Ei\1"l'JIFI|3.'L%.'I'Ii3Ii‘f dnND JI-NY-"-EF1'1I'il'-:5t".['1'lZl|?\' fimtlrfltltxrt nf fiuaiixr . I 3591 C STREET '.;u1y 2L1, 1570 ~- Washington, D. E. Refer: -:_. -Feéeral Bureau of Investigetian Id entificat inn ]II:i.1.|"i,5 inn Eentl eman: If 11° -1 42$-:_a_. subject?» in California bu employee. t may on ean identif Exturtzen CELEB. [N Bass INF 1 Latent Fingererint Section , please cum are 5-1? —1F -311'-IFS-SE61 I #9-49911. Earn hi '}*~Jm_._r_:,g_otfi,=_ N.» .- 5 no prints on file e; or have been; a Federal Thank you for your assistance in this investigation. MI-EN: 1:11 5 §Ei'r5e1' Very truly yeurs, e A. * . x - ' "““"*““““*F"w~—~—~__Jl:vQfl£Jfi4¢m 57%.’ L. CUFFE Chief of Eur ; ,&x$ «gs- er-'*;=:?xr- u . __IE|. J. Hm.» DE-u'1:r m-:'.—. A. 1. Sci: -cl-§,I$Fc|:=':n. w.|r- mn:_u::: =_ -a. nu lag J§5‘E"r’3¢ £3 ,:._ ============================================= ./texts/FBIZodiac4/231.txt ======= ============================================= ./texts/FBIZodiac4/232.txt ======= 1.15 43:». Ll-:-Ea: - 1_ - ta .- _ . ggag .' ' _ J _ -‘ ‘-new’: . FEDERAL BUREAU OF [HVE3TIGATiC|N LATENT FJNGEHPRIMT SECTION WORK SHEET Ha-named: 'i'—28~ '?CI 19 :55 p .111. Fleieience Na: _ FBI File 390: Eé,-cgiyad: ?-28-- 5,0 — -a.mh . . . I / ' Answer to: H1‘. H.Z""I.-"."-'*f.'u"f?f.f_fl,7=' fllliéf, "E11. ' ifi-cation élfi 3/ Investigation, aepartmant of Justice, Post affine BOX 1559; Eacramgnto, California 9550?. Examination req ueated. by: addressee . #1,...’ _ J _. _ _-,..- 2 __ _:.__ __;;:_;_~I,:- _- . E,__ v s'mR:::Ln,*‘°-’" ‘°_’ ./ ._ ; .'._a é-‘X .r:;n€?‘F.:I,.-u" E 1 Jé-5II;I-5‘$"n‘f'rei'Esxra1sc-3éommunioatic-ur LE"£~'h'?-'1‘ +3‘-113:‘ 21: 19?) -i'':‘§1:}9-cim3J35: flame ' a ' _ _¥_ . .. 3°13‘ . .- « L1“ - ' Result of examination: Emminqtiau 1:‘)-'= F q. E}-n'.d3J:u:3 noted in _ :15: 712,2" “)2; LN" _ . (U4 - Exuminmtiun cdmpleted '_mE - Q] U? '0 Dictclted g J I ' —-=4»-35'.‘ “iv --—--——-r—v-r-—-u-—w..-..:.,.._._...,,,._,., _ ______ ___._,._,._..._,...,.,.,,_.,..._ .......,._,...,_.._.. ,__.._ _ ============================================= ./texts/FBIZodiac4/233.txt ======= ============================================= ./texts/FBIZodiac4/234.txt ======= ‘M "* ==-~.-:v_r;_n;:1L.. aumu? or. .lHw3'“IiGAII_u'=='.3 L- I3.. 0. 2553? "ME. ============================================= ./texts/FBIZodiac4/235.txt ======= §- - ' -. _,I'''''._\. '\.,«=*’ $4.; [Hui-. L2l—B—6-5] -{‘?"::3. - FEDERAL EIURE.-RU c-1:‘ INVESTIGATION LATENT F'INGEP.a‘-‘HINT SECTION worth". SHEET /_, 9-2296 Recfildedi I"-30-}"U 1:55 p.1EI1.. fieference Nu: ' F£IFi.EB«P1¢.' 9-49911 _ 5-. - HE:~=-at-re-5: '_.'_3|;._:.rg_ _ lmk _ ' Latent Cage Na.-fl_1.m:,42 nus-mm; SAG, SAH Pmmclscu ‘ "L " ' _ Exdlfléflfliififl requesied. by: L Adfirgssgg ‘G°F*3"°*'1a=SAfl,_5AflRAHE1¥:IugfF—GE,5_.’f{:' ' _ .- '.HE: "H ' EIETURTIUH v '*:-i2i§k.é.o¢_te.‘-22-ante mmmuuication: _q_j_+_-1:31 7:‘,-'g_3..r';r.;} / r ..JfE'-c:'4_4,.,,r_':_7.._'I' —~5’r"4‘~,J:: Exnrninutinn completed ‘fir’ "5 t ‘:3 Dlctcried J 7m _ . , 3 um at 2 ‘Q’ ate -w-v-vjv-T-—v--w-vw-u-awe-I--:u-n-w-.-...j—-w---....:.u :j.__-_ _. .._ ._.... ....... __ m...-..—... ..-.._ ,,.,_,,,_,.._ _.__.. ============================================= ./texts/FBIZodiac4/236.txt ======= w hmg'1‘u:n, p" e§fil'_ __BliIiEAIJ'-*- ? J3 Ft.-'flFfl'§.n'1'E.D F0 -‘r-::_.s_:5ws qmr:I' ============================================= ./texts/FBIZodiac4/237.txt ======= u:a‘;5:;r;rLuno|nii:1-ml Flu-Iw ============================================= ./texts/FBIZodiac4/238.txt ======= ============================================= ./texts/FBIZodiac4/239.txt ======= .=_ ' ' . _ J; 1 — L_:Lh Files :..a_L::nlurmn_'r_” IA'ti'M:MIs1"n La'r'J -'r_sL€-T5's=: I I I ' ' ============================================= ./texts/FBIZodiac4/240.txt ======= 1 - Lab file. .._;'.-"mi---”-' ' u" “’3’.fi"|1!1'.73.’1',3.,:'I-i-’-".;- .”""i3'n-13%;;-F“ f‘ ============================================= ./texts/FBIZodiac4/241.txt ======= J 1'3 - ,-—\I ' ' :3 (71 in: L32’ REGDRDED FEDERAL EEUHEHEU CIF ENVESTZGATIDN 3;-4},>-ml JUNETEIJ STATES DEPARTMENT Ci]-' JU$T§'G€ ‘ 115 P L-cthwrutclrv Work She-at LAB FILE RB: gun-[AC3 File if g.-gg911-~Jj‘j‘ = . ax:-amnion - . D31» ?‘ n—7'-:m?31u3n -"LL 9'” “*=3-'fl=Wi'= ' ‘ " - ¢n—1353.5 .11: E=turI:.incI1i.<:IzI. requested by.- Ekuminéiiéfiéqués t?d:_ ' F|eé.1J.1t of Examination: E11252 Q25! Quit 2 - lactanta (sass) n1rtn1 1;29x7u sale; Emm-31530 {9—229s} D°GUnt “ Criptunaigsil, Emil Iu.iJL<:':.1<>rI bar: H.z:2~_ ~- Sil-ecimena subhitied IE:-J: B>c<:Im.J'3u:tti<3n Phfitfifitsw of G-'!‘l1'E.'I.fl-pa postmuicnd “BAH snmcxsm 531-15 PM 19?9 ca." bearing the hang Printed address "S.F. Chronicle Eng Fran. c1n1£,- Phntwupr at unvalopa pulltnaariuaui '5nn.rn}m:c1sm an 53 H5 2-1 5711- 1970;“ basting the Hana printed 8ddruIl'*E-r. Chronicle San Fran. Calif‘ Phctacwax-hearing hand nrinted nnnnagn beginning 'fih1- 1: thu 5 3 ch haaaull run plow h¢.§?‘f*ing an ta !x unhaPPr {aufitinund on (pugnj 7% Date: mania.-cu-.E: ’ ' -JIJ/31}!-in W1 2' ============================================= ./texts/FBIZodiac4/242.txt ======= Ph tncopy haarin hand printed message bagiflfiinfi acss "A: non day it gay hnpfifl that 3 7i¢t°m-“flat be fauna 1'. .’ ~'. ' 5 kn baa in hafid'pr1nted flflssage bfifiinfliflg “*5 "'1":::¢::Ytha speaking am an »«m not wear . . a" The reference to the It. n1§h1u code in Specimen Qcfid probably refers to the.map contgined in Qu51,_prav1au51y submitted, which included It; Diahln. ' ' . _ . ___. __——...-......,_,°...‘,,.._-,.___,,_ ___ u=+~»;.__ specimens Qc54 and Qcfifi contain text taken from a ,$9qg at Ku—Ko, the Lord High Executioner, in Act I oi the - Lsflmda, by Gilbert and-fiullivan. _ — The reference to billiard piayers in Qcfifi may have i‘ ~heeq taken iron a song sung by the H1kadn_1n act II oi the _sale play. . - E ; Ru cndé or Biphar material was: found in Bpacinens Q¢52 through Qcfifi. _ - - ..RaauIt of dhcument exam1n:t1on*was¥‘furnished 'Eapnrg§a1yo -. _ * .--' EP§GiI&fl8 Q@52 through Qcfifl are being retaiqed. Ix. rage I D—?flfl?31flBD LL_ ============================================= ./texts/FBIZodiac4/243.txt ======= " i F3: ""533-'1-osaxia #3:" ':.saa1tA_:t3;:a2 ============================================= ./texts/FBIZodiac4/244.txt ======= E’-IT. To|=JI}T|. Hr. S.-al15-r_an—~— '- __M;:_'_"_|:|ED'|L1' ?t1[I._-ZE'15T=0'P-_""j.' _ ============================================= ./texts/FBIZodiac4/245.txt ======= ============================================= ./texts/FBIZodiac4/246.txt ======= _- "Q; % PDLIISE DEPAHYMENT - CITY AND |:E|L|NT‘£" EIF SAN FHANEIECIEI HALL ;:ur-.1um-u-as: _ - - ' asgl EIIYAMT $'I'IIEfl.'I' - --[E $.l.R I-‘flI'.i.1uEI51:cI. E.A.I.I;|:II:INI.-I 9|-Htlg ,' SM‘! FRAHCISCEG POLICE GFINE DH'|'£?‘3§}E‘*'?]'|’3"l"':“: ..;- JV-$P¢“7FF -'\r‘.'LI$='|-'“"LIW'C.|"'-52915; ' . - . '. 1A|..FREE:I .1, NELDEH ._ _ __ _ _ - -noII::_roII-oLIc: ‘*<-'.; " ' - ‘ . .. _ __. 5 m REPLV. FLE.-‘LEE REFER Tu ;'_.-_ aura FiI.'.'E.-" '§'£JriBTI"E5:T:'§ Latent ipl-:nta's.n homicide E'9.1ee_e w'nera"tna'.a'uapa:=: ta ‘ -‘as the EDDIMI. - - - ~ -. ;. ;Nu'Ifl&rD1:£5'1¢f‘='Ei‘-9 haafl! been reé-'!iVEd'b5.‘i' 1-I-'=_a1 new-tpeperé ire: this suspect. In the pest .:.*|5«-zvitdeyfitne. has been :i.nI::1'I:ded. in some of therlet-t-era that etrongl;-z ind.-‘mate tCh:i..e. 51:51;-e<;t ' E is iujlfolved in; tine-'he3cuici:1es in question. ' Several a5-':I_ tun additional letters were ' rcacs-33‘i"I':'Ii~*9,:n—.s:' loeal newspaper. A hazmdwrriting cemgariseu indicates these last. the letters E the same individual. - . _ ; _ '- ' "git?! late-at fingerprints weI'e_‘6e1.re1oped, from O-11!; pf ting letters. Thege prints are fray: _]'t'nl'D diffeztént 1:-a5¢a- It is pnssible to wieterntine the pattern of each of the prints. AJIJ. _'a1"E| ifidifiduall? iéezficifiabls with the pnssihla exception of the_p:-int that is he:IJ.eve:-1"‘-'._ ’=%';K-* -3 1'-°_h€‘.1'-h¢'1'iEJ.It lifitle finger; 3:1}: of the latent prints were de~.re1aped.' an the letter ,.«_ fit 11' 3 ‘F935 ti-"11" that 1'-1‘5-i¢-5t95 H1-E31’ B-?'E i||1i?'!'EEI$iG1':I£l |}1"t-he: mi-:1-113... little ' ::e_ 3.11% isfit gang. 'I‘wer {>f'_t]1e, latent may §:e_c-f _thE -thumb or index 43 : -E 5 an e 3:: . . ' _ - -- ,3 _ . ' minatitm Print-5 have been ubtainefi of all persons conneetefi. with the newspaper and itrhfi Ffllite Bflpartment the caulfl. have pa-seiblgr heuuiled. the letters. The lateint prints __ Va nut been eliminate-E. It may he noted that it ia 'pas's:'.b.'I.E- tab (Eaten-|::i_n3 the jpa_tt.a:|_-.11.": 1? all Figlft prints. and the suhsecondary ‘of the right middle and the left ring. Beer; ,; ible primary alas-sifiuatiqai Em been searched iii the "San 5':-Rennie-::a IdeJ:1ti£‘i'I:::-Lti.o:1_ -;5'l1='E£|fii- H1111 "l-T flihi W 5¢¢‘J3£lI'1ét1'3F$. The re-salts have "IJE-EIZI. negative. This "aea_r;h will, be ficontiu-IE-=1 ta include e.T.R second.-arye end. amsjl letter sections 1’c.r.‘;|:.¢ thumbs. A -fwtaticll is 3:3-an-zed owes‘ each Latent 'prfi.nt we are nencsiug yuu_infli::atir:].,g: frornita gnoaitifln an the letter the particular finger we ‘eezieu-e tn;at'_it: £3. _ ., ,= I 1:$.}:"D-L{{-'a:;Ie?fi(-Rb):\'g-- »‘._.=.~'g;'u:'.é" in fete. tn" ‘.I'1:|_.e2e:ei£" " .,-- ‘ .-a. '?J-‘I33-6 DEFBYWEHT 1m-Lari greatly egupreieiete a.ia-"a'eaia_ .§e£Ee¢t:£ng ..-m identification in this .:s,.;-;__ _- ' ' ' ii-“lease r1iré¢t'*s.n:r comeuxnicafion or'i=_iq14irrf:reeaxaies_’tha at'é'nt"i:§—.L£1-.é"£n 'tréis'u':'aee = " *mp.~=:.ujnha’1"’. ‘ V. .- - e -Prime Laharatnry « - -. ' - . +'33In'1-":‘&n¢,ia<:a Paflica flepartnfeznt ' ' ' $1911 of Justice . 15,55 E-“yam: -Street '2.5an E_r'an-aria-:a. California 941D} -_: '- P \_ . _ g J. 1;5't‘?~ W3;/; ggsifi _. : ' .3111»: Eraly, ============================================= ./texts/FBIZodiac4/247.txt ======= njumu; _ 'I’I'-us_hi=1_<§i|?_3_'lL ============================================= ./texts/FBIZodiac4/248.txt ======= ============================================= ./texts/FBIZodiac4/249.txt ======= L-I'M lF|a-.'|l-6-*3} - _“._ .r’:‘_‘._ u .-.-_,_.? FEDERAL BUREAU OF INUESTIGFLTIUPE LATENT FINGEHFRINT SECTION WORK SHEET Records-=1: 3-3-75, 9305 3.. D1. - fieierxeuca Na: 9"3333 ____ I='E'.IFi1-2 No: 9419911 Hgceived: 3—3—";"_l3; jag‘ J Lctient Case No: A__1{I|:I_42 -‘U55-'*"3' W: SAC, 5111- I;'1‘3_'l'I!'_'.'1;5I3D-- _ ' ', " ' E:-ztmincrtion Iequeet-ad tn-': Add;-essee Gm t='.»'.__ ' __ . . he-. -mionmc ' - «- -J .. " - EXTOHTIGN _ -- fl,{,_f-,,<{:H. mg? 'L1:'T'“ /,1 ' - . I - fir/’:n;.-‘-ax. 7 3h.‘ F El __ _:_-§Iacr|:e_ of Iefexeune ¢omuIL=:n.'u:n1LiorI.: L 1-hrtel, 'i'—31—’i'I} Q;_I’°éi:EI'|:iens.' -'-' '*-'- 3 ph-atugrapha latent impressbtnns cs'.a£.i«,‘.{¢'5i.,.¢/-5:7-.1L2.¢a '.'i‘-'4'.i‘_2":)';;"fi,tz;/1.:-<2-:>».4.,.....»’ ,,_ 1.,,“é r.1..'3 +qeK.¢¢.:=»a-x. 3 Czar-'f¢-I—£-d.-r Also 511hm:1fl:ed: Police-ereport - yfb Fleaulr. :r:-E axummutiun: 5:Ii:I|;:i:.:;i::t:;-;_ . ¢Mz%a.:f’Maem 4.; M ,m,gi:g,,4;@?L,,g% % ééw «=;w«ew¢:fig; avian- :._«_~ 2,-fi.::~;ée/r/Lfiy-_.-;a F :-;":e1/J-4,1,.4— 3:6 - - |'r.-".?~r-.-- Coy»-F#T.?;.‘.;a 1_.-:.1fl:-.r: ;—f:2’é4.«.:";’. .1-.»->5-..,.:' M ,..q_;_Jfl:,2i?;.x ;g,s¢,.¢«.,,.w 915 flé ~ . _ ,. '9’ » :3 . " .‘ E ‘ .-,£~r.«-up-a.v:~.¢:_,._xfiL' (:7h_"-1? £[/B/£’(<£§".? /VJ “ ' - Exumzmtion completed _./jflalji-jrnéjfjl‘ I ' ‘I 95' Di.ct'.|{5’J U [13]-I5) CF EbI|{‘9) El [bJ-{E3 El lnfcinunliuu. pertained cluljr to a fiu'.Iv:I pan)‘ with no I.'CfE:I':.DC-I: to ab; subjm uf ]rI:Iu: rcqucst DI the .3-I.L'b_iDcI: uE your :I'€:c[U.I:°,G-‘t l.s1i$I£x1i:1t.tL¢ =:‘utl¢ om)-2 III for review and d.'i!'D!.TI response In gmu. Ducume.-,ur: originated w1'.d1a:|1m:IaIiu1:I fI.II13i.5h.:Id byancrflna GU\'|?.Cl'El.El'lE:11". B§'EI1C_‘p'fiE-E}. You will be ad-.-E906 by 111: FBI as D} we raleasaiailiry of this i:IJ.f°é'I="£|?J'a.tJs: . I,-‘H’ D33 _.. _..».a .n_A..a..—...{._ - ._r__-:€f_-- Hammad Suspects: W Twm -> w ¢~»+e % {*»-4-—f,b+4,)_ ;- ‘fjfi ‘£2 5 _ R2-sultoiexumlauuong _ ‘I _ . I-:v:«aen‘S:s_'v‘«aia‘£a:-oi? . 2+5; €55“ __ _ -_ ;_ _...- ' :1’ .5’ 5 539 U 5 5; E:-acrainutlon couupi-gvtgd E’ 7-42' Di.-_1uj.:__.d 3' 1&1 fir . " {me But Dqtgm - +4-.-E. " '_-c',5.._:\ _ .:_ _- . -_ _,_____.. .. __... , .-_'-»~:-'.v:"-.> .-.- = _ _- N-__'J_\.y'-'1 _-_.- ============================================= ./texts/FBIZodiac4/254.txt ======= _.; |_..-as |1::g-u. 1;-a-EN .-_‘ E .1 * '*‘=fi=' * FEDERAL BUREAU OF INVESTIGF-TIUN LATE NT FENGERPHINT SECTION ‘FORK SHE ET ',R_eI:-D|:dgd,'. ?- 1.0-:"U, 1:10 Pig’. Refeze-:1-ge N-9: 9—_2]_CI$ FE-IFELE Na: 5-_,;g9]_1,.J.I"'5F‘]f' .. . Hecsiwmd: 7._1fl._?0’ ch ' ' Latent Case No: fi_lDO,_:};2 - ._ : Answer ‘La: SAC, SE.‘ Louils " H ‘I '. . .. ,..,_ __ - _ Examination requested bar: Addressee _1 Copy ta: U",3—~S&.C, Sacramento ‘Q ""3-=~'zonI.a.c ' "C -- . ,_ 3 EB‘ . ' Eirr-faiflzan " "' ' ' " - |;_-gte nf IEEEIEEICQ communication: ' ' _§hua.ns: 3551 . _ baa um, n«::-a- 5 _ , -fie-:-..«;.,._,, .3-,-_ 945,, /’n%g«’—¢;.z,-r~;/5) -Airtel: 5-30-15 Ev idgnca noted by: BE.'$K.l.h of examination; Examination 133'! - . - :- "?{'.-I aw“? *'"~°-"~¢‘5**"*“°%‘*‘ . . ,/‘"4-M*‘r'L—i;=-n~1A?i::/2‘ 7 L-mu. mu2*,e=‘,;§,;2a€g_." I 1 ’?"*/- ’;’”*‘,“‘"”—‘€‘””’/"%‘.‘i“f"a‘{*§J‘§i"i':«%**‘:*.‘9'f?**%' w ; E'.xa|3I'mcItion eumtalgigd flL "9 Time Dc: ============================================= ./texts/FBIZodiac4/255.txt ======= Luclwructurr ":'-.“J:rI\.v.u.II;_Ie_Jl rare, ‘P?’-1 3r "gm: M] M I 551' P. AT-a ‘u'»E...§>~.6'.-13:-E;_ w_U_E..::: , __ _. . ============================================= ./texts/FBIZodiac4/256.txt ======= 1 - Lab Files-' ============================================= ./texts/FBIZodiac4/257.txt ======= ='=--as IcI_=_-r— :v-«J-1| ' ' " ' " ‘FBI 3"?‘ 7.-"2 93' 7IZ| Trgn:rrrit Ibo 4u11uuri,o.t.~ i:I ___|_r__Jw-v-v-u\r—1 flfpg mp.:.n.-‘mu womci mu -E-IRTEL - - 151‘-’ 2 .-.9: _J:-zmacrun, PEI :9-$99.11.} {Ex {a:tu.= 231 LAEOE&tUR?] . rank: Ac, am: Eamcram cs-2295} :9} su c mum: ' :E2§'1'ElR"E'ICIH 3' _‘=_CI8fl ' DU! Eacrangntu ,-1'3}-4-5 39 San Ft‘-aznzir--=:r 5.i:r1;ws.1 4:-:> Bureau, aatsd ‘U23.-"J‘E|. ~ . (§*'-F’ 5=|«¢L9-5e><3 fur {the Bureau are 1::m 009135 consisting of four pages each of 1=ut=e=,t two letter: and gnveJ.oy3s"I€x-um LFNSUB, thifi rnattte-1% Envelnby-=5 are 9 _d_ E-gm -9:; 1 % 3.9%; .. SfiI‘1'F_1'_‘S_ EDDY ms‘.-'nfi‘r1L'n'Ttn-. ,ua _ flI'a'i1.i'n_1.3'.':r:_+1?" r-:1i1_=:5i.'fi. 'ra'-ifré 3f. Ei5'f"B'r:'EfiS"i‘_’ :- - ' -. -- '\.fl- '.---- L." - '-_-': _'.~ ;I'- _:- ' 1 - f ‘ _' ' "' ' - "- H v.-:..'.-:: .~.- .' ..-. -.. . f. _ '33-z= "r-"' '-. ' 2 13- I: ' 'é.U.Pf'§‘5i"'9F F'-'*‘’1.-.'-F¥.t?.I.''—!5 .1 =!rI1-.!,¢='.?.«..'1‘‘“I§.*=?‘"’*'’' ============================================= ./texts/FBIZodiac5/10.txt ======= 11.Bi‘§K1'ujI:Ii:»i.1i_:+ '2 in 1€._?.'3S5IaL=:',*' _ _ '-.-' v -- :.' 2:‘ . . . '*~~.'é‘5'-’-o-5-rxea.-.'-4: :'. -- I. 5:. . ____§:--ta_-;J.1'.1_!ie' nits‘-£_‘AcI;_ ‘E i_n§§§5'” '9 "it; as":-.:EE=*rz Em Infraléirzt iii?e°E:IiF1‘5‘*i5 EH "1;'D'$htfiA'HE'Tl'f'-Q _ ============================================= ./texts/FBIZodiac5/11.txt ======= .i _¢g' -::'ciuhe'1- 22, iirio- ""'*""" ssrgcnap it-iv-ESTIGATIVE DWIHIEJN Eodiac is His alias of the West Coast murderer who claims 1:: hangs kiilsd L3 people and -ism:-‘is believed ' . by police anthoritiss ds.fi.nioe'1:.'_ responsible fog‘ sci-e:j._ marders'.' We are not éicitvely "investigating jiie-.-sin;-idem-s but ||2.EIIi.d'LlI2t out of state in‘i*v.=.,5_tig:a._!;'L:I_I'1 fa-1' l::.t:.:_a_1 guthnrifies ' .: fin limited has'1s.___ Several ZC:v:;iai:'._'. threats. |_1a,'.re been __ ' mailed and the Eiircau has an Extortion case, however, 'U'-_- 5- At“t0I'1'1E1r" has i!1dic3.'led'p_1,"e£ersi1I:s for pmsschtiprg ' " l local authorities on inurdei-‘char’ . - _ ..-.;e.,;__._ . E Attache-J discloses a reata¢ _ - .. "" ' in Unit: on a charge of in 1- si-sin mct.im's body 1 '““ was mutilated inchitiing the cutting of a "Z" on her abdomen. Two Negro prostitutes were found muxdgred .;in San Francisco during 5 ,f'?E}'wi1Ji mutilations similar _ bill:-ito the Ohio death. San Francisco authorities requested - _i 5":-1,ssi,s.ta_m3e in obtain‘ in ' case pri.nts',' p|ioto'gf~g'.phs. and whereabouts c 1_u1-ing sfiruj 1r apptl-.g - 5, Cincinnati 1.=.=i11 can c _' s J_i.miI'.ecl iJi_-iresiigation I § 1" squ as bad. _ " ' B.HC:fw _ _ .-_--.- - -4 .;=.r_'"{*~t"'31~ 4?» %ll}‘'*§’/x’~- 9' [J5 ============================================= ./texts/FBIZodiac5/12.txt ======= ============================================= ./texts/FBIZodiac5/13.txt ======= :1 Ir§£i_4r1ric?Afi_[c_.*_I_4 L"; T E"r‘I"*r"-"I-“'4 riI"13'E"1% H‘: H :s_ gz'c'_'I"1‘Er' __ H _.3. H _ um-' TE-TU : i 2 Exminaiion nr§r:IJp!e'ted _./¥'| 30' 1:0 7" *7 Dictatgd /0 i? e c: e ' Tim-.- H|.4—u-I-UIUI-lI"\'|I-F'V'T\F\'|'1*.U\n0-:'a._‘t¢:.g;4por ============================================= ./texts/FBIZodiac5/19.txt ======= F 5': Date: ;|_I3;'2SI,9'?|3I TE‘U‘I'L3-:1'.i.t the F<:uL1<:uI-nnu in I"'n";‘_[Ic in P asst: act nu’ fun!-1.-' V. AIRTEL "AIR HAIL ; E” g.°rmrr:;,-J ._} ____________________________________________ __ : _ : DIRECTOR, FBI (9—¢9911J i ,-L: n.1'-:':?.q: FBI i.ua‘a%:-2A'£Ua3:' i_ : SAC. ma '..:a«-cxsco I]9—2.ZEl'E>] LP} : RE -- ~ ; zopmc 25:-rr.':-iz'1'Ic:n: . ._ _ E CID: San:3:a.men ta IE —. .._. -_ \ J.og2«s,r7n::. —-L P.EEl.ul._et to San Fl.'E.n.'1'=LS¢-54. __ En¢}_osed herewith for the Bureau i3 0H9 PhDt*'-‘-~'=E'P‘;' __ ,'* and one xerox can of card and euvakogne which envelolf-fie 5-5 .1 -‘I .- a,dd1‘_"E‘ESEd tD "5.a-_n Erangigcn |:hrDn:'Ll:._lQ_I|' 5th _mr'_'~" and i*T.1'.55in:In S rests, an Erancis-c::::.r and postmarked at | San Ezancisco, 1|Z|_r"'2'.5',.'"7"E5- I " Enclosed for Sacramento is one Harm: 605?? Of Ea-FIE _ , -' ~~ Bureau. en-:1.-::sura. 1 an lg,-ggffifl Inspector! San Fxancisco E ‘* Police De t. advised anclasa emre spa and carci receivg-:2 vrxiter for "San Fran isco rO3'Li.E=lE"r dfl-1'-13' J/2S.‘.*'_.I'|:I+ Inspactu dvis-ed $13.’. Nada card, and envelope-a-v .1. an E 0 S-FPS an 10,"29f7'}- The Labnratozy is raqigeffied to compare the enclosed specimens with pre ' '11.. Er_"m2nE: submitted 11! this: case. 1.3% ,3‘ I . 3- BUREAU t9—-1.9911}:-iancs. '} C77__ — sacmazmo {9—-Es) mac. 1] (Am gm-43 J 2- am: rmmcxsco t9—229»5‘.u '-"' .'-‘G 5 CEG,.-’a.11':c ’ I _ _ .. __ 5 _..flFT_¢_3?‘ ta ta: '-__ " -103. ’i''‘‘‘‘‘' -’f_...-_ J, J :r;» « I" I 1 -* 2 .rf_ x J J’ "Th _ fl Seni #111 Per 5 Agent in Charge ============================================= ./texts/FBIZodiac5/20.txt ======= ============================================= ./texts/FBIZodiac5/21.txt ======= OIPCA-I-‘J0 [llé-931 FEDERAL BUREAU OF IN"'I".E3TIG§LTI'ON FCIIFA DELETED P.-!.GE ]NE'DRMJtT[DN SEE PDDCEJICIIC -.3 -'I’agB-{3} witllheld BJ1t1'I'Bi_'r at flLisl<.~=a1'L1:41 in the fits; CI-nc var more :11’ the followings:-mm-:nLa_. whet: imn-;m-.u__ M913-111 !»hi.5 i-clarion. H Ihstltfious were made pal‘:-Ilmt to £13: rmcmptiuns indicated below wlthno s::g.rI:g>a1:I|.c InaJ:r-:rial available for Ieleass to you. C‘ (E9-(‘J El mm U {tIJ':'3I' :1 urn:-my E! Iibllffil U |ZhF'[6} E-Eiigsfi El t't'JI1'?}{-‘J U -l'b}'T|-{B3 P1 {b}f’7J-{C} $3‘ {|=}["U(D) '3 WITZICEJ El ft-‘.>I2T,'CF) D GJEEECI El (UH?) Setting. 55g; :1 {anti} '3 Kim I III {km} _EI anti} El maps} III mt-1} El Ivtfunfiafion P*39Trii-|3I|‘fi Uni? 10 2 Ihird part? with no mfetnetm no the subject nfxour rcqunst cur flu: subjm ufycrw: mama: is listed. in 111-: title: <:u:IJ,3.'. U DGCUIJIGEILS Elfiginalbi '-1".il1J ailutbfl Gm-Exumlmt 3,gI!.D.C}:'[l¢5)- Tblsn ducI.u.:J.ems ween: 2l'B.58l'.I'Bd. to 1213': agencyfiesj for review and d.1'I-am Ifififlfilflfifl 1.3 you. j Pages c-Uniain infomlaflcrn furnished by aamthet Govarnmmt -3220.2:-'(ir°_sJ. You wiilbc advtsml 1:v3.rl'.lJ.I: FBI as In me m1::a5a.bi]il'_'r uf this i:nI'cIrmaLin:I|:L fi:Il1cwri.11.g4:t1JJ' nunsulaafinn wlfij, me ome-,r aggpc;-(jag). d.'r4-position at a lam: dam. P5 The fiollwriilgnumber L5 to be used for reference regarding; Umzae pagw Pass: were not13=c|;1z-ids-.re.d for [E15353 as they eat du:fl'u:a.I:i-ac of Page(-5) wiLb.l:IcC|d. for T113: fiolluwing reasunlfisj: Pagtfisj '#J'U:t|:I.cJ:1 iuasmuui as a final Iclease d.Bt6l'Il2l2iJ'la1.iEI|2| has cunt been made. You willbe aadu-j,-smcl 3.5 In I;',t|.c -4- ¥;1.-i__..~I:1.J::.J:.r., L?..__J.-l- Ekgg. |__ = _, 2 5:» -6» - ~.« :'—-~., _."" -'5-:19’-"0_ - 3 . - F51 -an 9:ns1§1;_. IS ' F'-£=- ~-".'-5?-.<.=3%»’.fi=‘f0:i;1e£el99¢ mmnwzoal --- ' _ - :D‘u":’*:.‘{':)-L‘.¢'-':;.{-:-'-'-.2 \~ 5. ' ' " ' 1811} A lflgéz. ' W =.-">floi.-31'-Inan.‘¥9 9 »-s:~.-=.=r,.l1-:%qe_:-.w-._:'- ;~_.:,;~£='_=.=»;-,.-; .--1;.‘-.-= '_~.' Examination rscrues Esd ]J'}'_: ' Emmiraatimmquagwd: - Flasull cxf Examination: Named Bus e«'_*'I::..r'.*.'-‘>2’ ' -.-+.‘§.-TfQ"=C'-It - - iI’e1'1=#I.,4-w9- 2%-.’.°*‘ ' -x. 2-éilgrlfiiynhn [9-53} Fxamination completed -5 E.'ff;f;fi] 2' -4" PM . “E ============================================= ./texts/FBIZodiac5/30.txt ======= aacrwn (E2-3-965 ' F j XXJCUEX XXKXXX FEDER.-'-KL FLIREAU OF ]N'l"E5T[GA’I'IC'N PUIPA DELETED PAGE |JV|'EO'R.i\II.e'|"l'IDN SHEET Paselisj wlthhfild cmirnly ax this tocaxlncn in the me. Um: ur mom uf nu: iolluu-ings1a1eu-guts. 'w‘hE:t1°_- hldjmtvsd. explain this draletiu:-rm. El Deletions were mafia |_I|L1l'-E-1L&1|'lT 113- the ¢JtE!£o.}?I3I:Iu5 indicmad below wlmm sggagebje u1,a1zer:ia,] 9,1.-aj|,ah]e im- rclcasn to you. ~&.';e.,T'_§.«J1 mmm El WEI? D lib}-{7J(:*£I U [d}[5J '3 Chm} El lib}?-'?I|2E‘-3' U [I|(2I' U (W31 El I.'tI)L”U|IC}| U UCJIIIJ _ U [bJ|Ci'}|ID} El {JCJCZII _ U |.'bJU}[EI El '1'k)|C33' _ El {HJFTHFJ U (1:]|[-i-} U {bZI(4II U 'IbII[3} U 0:35,? Cl 'CbJ(5} U |Cb}[93 El fl:II[E3 C4 ('bI'E5} El [K-‘-€37) El Iflfttlmaaflavn prmaiuud uuiy to 3 third ]}€I.tt:-' withruu mfurcnu: to flu: subject of}-our requas: or flu; subject cd;'_'_arou|,' Iequest is ilst-213 in the title only. I: Ducumems -:'1'1gi.DsI-==cl with armtha: Gm'I:J:U.u'|.E:rLt agsncyfies). Tlsasa docunrrfiuts wm referred to ma: agemylfits} in: II::v‘Ir:w and direct response In \_-'uu. Pages mnuin iufomation flnrnished V‘-'1-'9-11flI:bM GI:13'r:I'|:Lu1-=.:n1 agancjnjiaal. You wiilbe a.<1-urisnci byibc FBI as 1:} me mleasabilinr Uffllifi Lnfunnaxine Eouowmgmtr E:):IJ.S1.1[t.a'II'lc\u1 wifi: the other a.ge'I:I':}'Ifir:s_‘.n. P3§8[~5) Wl1f1!1E1d inasmuch as I final I-sleaze demrmhaallan has wt b-cm: 1:|1ad3. You 1:.-Lllb-a amlvjsnd as to the v.1‘_ispos'Lti.ou1 at a [any data. é Page-.s were not mnsida-red for IE-J|:a,5¢ as may 3.1:»; du_P]jc=a|i1.ne of 2- fly“ g 3 Pageals) W:iU3.h&]:1 forths =‘o]lu'a'i1:|5 r-sasnnljsj: II Th»: follow»-tln.g1sumI>er is U: be used for reference rs ‘mg 111-La: pages; 9- we» 35': Mg }'CXKXX3C6LXX}{}'L'.!CX'KKX X Dzletad Pggnugsj X X No DIupEi<:a1in:n,1 Pa; 15: X fur Unis 96.373 X KD{X?{}{?{JD{XXK3C‘GiKK 3 }L_}DS_.XX K Fg.]_1-pg] ============================================= ./texts/FBIZodiac5/31.txt ======= ============================================= ./texts/FBIZodiac5/32.txt ======= "'_L""f'*'l-'E[”,¢j'.-. _ Bumu or IN" mention _ 1\’1:*'.:‘i‘!I‘|’_ll'.:E}:|CI - _ ‘_’ J -'--,.-n-.: rau 54.5.1: :5 - 5_..1't'_1::.'-J- c _ - - _ 5 '- ' +;='a:;._' ‘ " “-“' ' flxui l=I_EEL=_t2_ENICE: 9:54-i;3cJCflIurgTsoxr"as-hvé-1-':aeh'a 2‘ '‘1'‘.'‘'\'' 4="-.- r 1 :r 4:5 rnrnsrssaraa r'r::1t'o2-”e°:i:mr. mas mar ============================================= ./texts/FBIZodiac5/33.txt ======= I.-G5 [F|.Iz1'- _LH-411) W ,3 .;- FEXDEHAL BUFEERLI OF INVESTIGATION LATENT FINGERFFIINT SECTION WORK SHEET‘ FE'=9§Cl=—'fl= ]_]_.-"?;"'.F'.".| 3:30 3.01.’ Refemncefio: 9-58 "BI F'1-E Na.‘ _ 5- 1 Hm:-aired: ll.-"9!’ TC‘ jdb - Eulcantl Case Nn:g;fE%$:2 1 -5-1133*“? 1“: SAC, Sacfémento Examination :2-quq>.s%ed, 1:-y: gddr easel; Cup:-' to: BE: "3 _ ‘ _IiLu.t:‘ ' ' " '”-* EXIHRTIGN DU’h=e OE 1:95:-n=r:Ica=e communicatiqsnj git fig-_L 1 -- -S="~i-w.*2*-2=:== Name-:1 Su -act: _ _ la‘T|'-" '3. . _. _ l','1r.. Result of e:cqm_iru:.Iti.on: , Emim-.m,._ Evidence noted. . 55-===w="J1.:a.£5€5z: 1 Hficaaivaflt ],1f19f?C|' BI ' Latent Cass Nu: ,p‘q_.. ]_CI'I:|¢’f;.2 3.’. _ . -"msweltc-= 531.0 3.111 Ffancia-ho — '_ _ __ __ E:-'.1=II.irJr:ttirJ1:I Iequesteci by: 1'19.-ddresgege Copy ta: ‘FEE: "ExmR"£‘Iu:1H __ ' ' " _ "H :Dcrt:a- OE refetwence cammuniuzqtinn: Atrtel 1 hr lgfjfl Result of examination: W4»-_-...m_ if: 32%;“ (,,95/ " Examination hf: — Evidence mated by. ‘I r" Examination, cognplgtgd % I’ -9.1 in:-3 «IE3 ============================================= ./texts/FBIZodiac5/37.txt ======= :1" -‘Ev n?°’Hn Di'r:-Lsiuzun, Latent Fingerprint fiectiorfll m AG, GINCIHIEAZI I:9—_21r:§5& ~El1UiJ} {:3 ' ' I . _ _._ ___ $T.I'.B_1'.5G'.r: _ ZDEIIJLG E}['i"CIEtTII.‘,II'T Efinzaaflfliétareifi} ’ __ are an Francisco a;i.:-tel to G1, 10?z9H?_Q_.___ -. - _ f ' mc1o:éc1'foi~ '*Efi:-2" “" " ' o u'élt::.='iiii.c -9: copy‘ of t e .£'i11ge_Ig:rin.ts of white male, ‘$4 burn a't»‘j:J;I§._*_-.I_‘__tI_.'_rn,-__ I’ ' I T: ' ' C-11 ].2.r’1f?C-Pflhiu Btzreau n:>f_ Criminal investigation -an Identification, Landon, G-11i_u::, - prov ed ‘ ‘ 't.:'L-:: cup]; of the fingerprints ' advised that his dep fr. ...’.'... do we 3. set of ma or E355 fingerprints for %§% % : §§.I=11~{:j13:r2;:;1Jr:§.5-cc: |I.ir:if"cii E9-2295? _ %7‘“‘~3x.- W-r:F,—'z-ii: _ REC-B 9- '5/<57‘?/f~ E ‘:3 vs: ''''°-- —; "- _ tII_ L:Ec—i-1: I910 _,__., \., . Ba-gr U3‘. .5'.a't.‘2'#g3 B5993! Rzgxfaiij 093 Ii Pgmfifi _";°m.I,5;:-;3,r Ping: :.-__ _. ,-_a-.__- -..-- . 4 E It is noted + tler County, '5“; - __ G'l‘1ir.‘J, has requested that °t ha inte E; viewed at this ‘time, imsmuc as_ _ .. _1s_1::-r_esent1]r charged. _- =5- - T-Pith first—degree murder arm the sheriff is‘ fearful tha ‘ I:-' an interview :1?» this tim-3 might prejudice this case. " E. - ' Tiierafcrz-e, nu attem t is 13-21 mafia to obtain major cage " . E firm-prints at H1 '5’ The Latent F1 erparint S ' a tad E to -compare enclosed finge 1-ints -: .—- with latent finger - ‘ts -_F---r ,L=.u m tte :9 __:,:.s E caae. ' ' ' ‘ ax — ]3‘%l_1'eau{Er1c-3 - Sacramento * ============================================= ./texts/FBIZodiac5/38.txt ======= sumu or mvr ‘=-I‘ bin-man. D. C. 2033 ' " L~:|:I - .3: 1-‘E-I1-"SL5 No: 9-49911,- Hecleiv-ed: Efgfif? 1 Lz1 cerrnpiet-ed Ti-m% ""-f"/K-_ ‘I Dtctatedfii ’LateF ============================================= ./texts/FBIZodiac5/46.txt ======= u§IIuIM.u=$I u:.pa _ *3 ' .“;::r;,:”a?:.;..W ._ 'UNiTE.D STATES -2-RINT SECTION, LATER? :3.-:53 #A—1o<:u42 SAG, SACRAMEEID £9753}ag_ £!.|'B]'E-QT: Egnyyg .7‘ ‘.4 f1’ ' ' 3 EETURTIUE -On 3!24;?1, Sgt._ScI-larfo qguriéy Sheriff's Dffice, F-5.;‘LrfiEJ_-:3", California, requesteai that the unidentified ‘Latent fingerprints previously davaioied hip in this case be com areal with the fi 2 Pints 0 . _ I SS He was - _,__- E __ '\=_' -" - =’1i“c~u§IvL e“i'=?//’ * /5' 7 @H - ‘E-_ Bureau éfflmflvflhw 1 - San Francisco {9-2296) {Info} Alfllrvqjlf 3 .Eq.PE?%'P?1H:"T 1 _- Sacramento #9 L?‘ _ FEE!-zjara ‘"*j—'— can ,_ £31“. "R “ W F. '*\-—-uuw-ur1j-II‘ 35-11‘ UK. .§'==a'n'H5J Bonds K:_ga:f.'¢:rI;r M ti:-: fqyyafl Saoirzgs Elm .‘ 9‘ ‘W.’ ============================================= ./texts/FBIZodiac5/47.txt ======= ""°""‘FEI'.|¥" "_’ BUREAU 0!’ [NW :5hT|0N W’. ' '-|!'us}t:i?I.<:I1':IrI..C'-C- 2::-5-:47.“ moat . ' *‘ ;i}§ '_ __ ._ _' ‘L . . .._.»_;:>E|:J1s. _ _ lDEHTi£lCA_TlON_"_DlV1$l_Ofl ; L _ r ': . U~T'i"‘*Ti.FII'HriEHFt.=uH.T..;s.E.n._:w;r-i - ' rut-IB}..“’EH%gE'-jg:--'.'_‘,,.. .:_ H 1-’_._.'l: I U I -- '._.'_<- FBIFI-u'_.E.b-ID. '- LA’1‘EILI"T crass No, _ _ war as 1=':.r:t.v.-':s‘:.rezEI FER orrxcm. 535 am? ' auamfi-Dnu _1“zr_t1'I-as un{rE:| ' ll ============================================= ./texts/FBIZodiac5/48.txt ======= L—d& ta:-r. '|L-6-E-3| E-" "~_ . -6 FEDERAL BUREAU OF DJUESTEGATION LATENT FENGEHPRJNT SECTION WORK SHEET Recorded: ._5_}']_ 9; 5.5 _ _ 11 Reference Ne: ‘ 9-68 E 4 a P3 FEE File No: 1. -g-4gg]_1 gé 1'? Pn9CEl§'{Bd: Ii -6-?1 It [_,.|:rtg_u!, C|:t;fi Nu: '\_‘ Answer Lo: _ ' Sfifixrfiacramento -_ ' " " ' Examination Iequeste-:5 by: Addressee Cop? ta: fig; flu‘.-"-_ .-.'. . , ""v~ -- ._.,_, . ' v V Exrazmzrrom ' . , ~:' _ ‘JI_§gc_{vtn=:- -rJ;;:fla-2-rence mrnrn1m.u:c(tjrm_ Letter’ &_1_;l1 ‘X A I Result U! examination: IL! vi) b E;cn;u1uu;ti_u-n_ by; _ Ema W Evidence named by: 5'} _*%—aeE-w»n5e*35~%*fl+w '*:"”_.¢’13%"’-‘“*H“E'Q*§€’“-5-l‘“*$‘ flag‘ 3°““7"+~s-rr.»‘e:-«::5= '£h:!'"1i_’3t_°}E) ============================================= ./texts/FBIZodiac5/49.txt ======= '1-\.a|5|?I.'I.jn. F‘-P13-.. Sulliupnj Huh ilieéinlf ' M1‘-3E'wnn1I;:I]D_ Hr. fl:n.E|nfr.a'n"_,,_§_ M-1'-_ Ffiaancr’ ' ".bc::.-‘-zonma’ PE: n mm-. 5.22.34} ' .6’ ============================================= ./texts/FBIZodiac5/50.txt ======= BUREAU ' OF INVF -_ lg,.:,5},;_:,,?1€._g1;-5:. :3. 25:53? _: _ iEiE'l'_lTI§l_C,_i'Tl_’t_Jl*l ;-;__'tji1nsILu';_a '; '; L_.'af_r'g_'g4'_‘Ij 5| Mfrs _E_:2i{.'21'rgZ3"‘:s E_ I:--Tgc'n_:e' HAIL mum: ‘TEL5'l1“!|‘I>r'.‘ um-r|:l . . .— ============================================= ./texts/FBIZodiac5/51.txt ======= Lava |s-cu. LL_va_n:I1 *1 -2 -1- ;-7:; - I-“E]:|EHP;L BUREAU CIF [N1u"E$'TEGATIDN LATENT FINGEHPHINT SECTIGN WORK SHEET Rec_'cIrde-cE: 8'3 "Ti ‘'3 : 05 p''m_‘-* J-e Re-fetxencn NDEFEESE '5 FE! 1-‘11e_F1‘u:3§4991 1 DA F-3: a§.\-'ad.:E- -3- T1 Lntt-3-at Case No: 12!! -1'3 finswm Lo: EAC: San_F'1:ancis-co" ' . .. ., _ _ ‘\ Emnlimtion xequsst-sad |:ur:j:H-jder-35 5.3% CUDYID: 1‘?-..‘». S CL‘!-—tE-($7) -- “\, ' 'x—_- = “HE: ZODIAC —u - .._ -M EXI’[1R'I'IDN - = _‘ 1 ,_Du_'tt.- of mvfe-mncg :::n;n:nunicutio.u.- Airtal ?-EU-?1 <fi'N-‘-'J1S=Named Bus Efft-1,DcuB #1, Dim l‘11;r-'Q,z.<_, ms} $74’ Ftesult of examination: -Q/fl.-_] Exumimijgn hy- "{'kqm,_‘.;. "13, I;'_~:fi;1 Evidence noted by,- am; 9»»gi=.§»»#»44_3.\am£|i§gT.mu«okn.;'«—A;q.L.1lw\sm.aé=u3§= — [5 Exmntnutinu cclmplséed 43*” 9-W‘ Gr 2 * Dictumd ‘I ,-3 Z 1 Time Bite‘ me ' ============================================= ./texts/FBIZodiac5/52.txt ======= Inomm. II ‘Q -. E""9“\'- - -Iurrullannwton -=|.nrrI-ar.IzI3u enflm-u.c UNITED 3151735 L ti-:__ Err: 39$‘ Mmorandum DIRECTOR, mi (949911) l2},.Ej,?1 ATTENTION: InE1:IIIF1c_ATIoN DIVISION mm: l.a1'I'ENT rmc-E1=u=*RINT dzcriml {IATEHT CASE‘. #A-10042) sec, sAL:Rm~1§H_:ro (9-53; ‘{3} $U1i:IEC'r-‘ '/2un1.su:: ' EXTCIRTIDIIT E -- -P‘-,q__ .. Encln-sad‘ herewith re -1:1-Le Bureau and San Fgasieiscn; ' X 1.? each of'f'c:ruI'.' letters. addressed £6 54% -_ Va1leja, Ca15.fernie_Resi.r.1ent Agency, frum ' 5:: I j“ 3 a _' ' the Bureau W1 nute, '5 developing e. The contents ve een discussed Vallejo Police, Departfient, and cl they have requeslzed that the -9. compared with the lagigntg finger- presentljr residing at California. _= _4 g It is requested the records r::- -A tification Division be checked for fingerprints on both ,criminal and civil, and that his prints e nompated with the laterlts previously developed. Results uf this examination should be furnished to both 5311 Francisco and fiacramenta. _«‘_'§[§\ L____,. Ifi?,g‘;i€-U" .' 9" 1:;/gww es ** . J-U’ E-Lgéjgfio _ Q3‘-6499:}!-35‘ 9 Q} Bureau (Enc.--it} REE?! ;""" '-j1_'u' 1' - I - 3 : gaazfiisgisco (9-229:5} _ -'3 DE -1-__,EL1311f 1 f " $1-:——u—-I—""‘: Pi ‘ (1 - ea-21A) FE? 1-3331: E Q ' ~ {3} kn‘ ._ _ ’_\h ‘;7‘— ewrr ~ fin "' 5&1’ U-«V 5'¢'**'i=.5I Berra?! Reufuve on rfie Pemil -Tswiag: rm ============================================= ./texts/FBIZodiac5/53.txt ======= ' ‘O 'HO 3 DH.'I"DlJ..'§!ANl lb ‘.3 N 3 (I L; I 1': l.N'h'E51'.5fl.TlD-N FEDEKA '::.c. r ============================================= ./texts/FBIZodiac5/54.txt ======= November 19, E9 1 _ —- -5&3-Mseshn -St. L;?(’; Vallejo * 1333 in my present review of the Eoéiso osse, I turned ut- =e couple more interesting itefis. ' In line with the finoings re moon phases that todist .-éahppegently uses in timing his muroere, E discovered that e full ,n-noon started the day before the Riverside City College coed murder "Hot. 30, 1966, in which he has been suspected. This tends to confirm those suspicions. also. I notioee that fiodieo*2 lest oonohniootion, e gostosrd olsieing e murder in the Tahoe eroa, went to the SE Chronicle e year to the day after the Hodesto area kidnap. “fifitfiefi Bttause he has market his “anniversaries” similarly before, this else tends to confirm his oertioipetion in that crime. You wouldn't think heffl consider that en eohiovemeht, but he must have got his jolliee by burning her station wagon. 'Or perhaps he did someone else in lstsr that night,__ ' _ ' ' Enclosed is a copy of s zeete tabulation 1 did on the pertinent moon phases since the SP oabbio muresr, sets for a couple Pisces Moon phases I don't have; ' It may he thst with several dozen known factors in his six known strikes, inolueing date one time. the time gets, the moon phases aha possibly suoh details as weapon caliber, a computer enulo be programmed to some up with probabilities on strike; after Got. 11, 1969. flee I mentioned, it appears he bee sterted a pattern of two firiosy strikes, the Saturday strikes, etc. In his estrologg, the number two appears highly significant, both because of it'bein5 the numerologicel number essignsd to the when and because the Zoeisc symbol for Pieces contains two fishs The ' other especially significant number for him is nine. He also a;pesrs.to'use the betio number system of numerology which, for exam lo, applies to dates gives on a basic number of.two for 12-2 -1963, anG'?EW3¥"rino for ¢££§$X'?—h—1969. Gorfii er ============================================= ./texts/FBIZodiac5/55.txt ======= _u' _ Sunday, Envemhcr 21, l??l ?$I E23 Marin St. ' . B15! Vfillejnl _flL$4Ja _ 1 W111 atop burying ybu in a bliazarfl at lettara with . . But I laasnad rap the first time in the 3acrém$nto' - ‘Bee today [new Secret “itn¢$$ program} of some fiétails of four ' _ wurflers of young wowen Shara. . § hgvs alregfiy nenfiiuna the fgkl 300$ ffiufitfiri MOOHJ that started ‘my. 13, lip’?-0. A IE-am. arol Hxlburn was murdarrsé ‘Rev. 1h. Tug firtigle 5139 tells of the kidnap afld muréer GE '9 nurse, Judith Hagfiri, who wag abducted from 5 grking 105 thg night of Harch T, 19?O. fit Pisces new moan i£§E§§§§“occurred Harsh 5 and ? that $€ur,x§fifl’%hers wa& a tntal eclipse afi the sun March T. Both of those sound-like they Gould hava been Zodiac‘2 mark. _ with rggard to the long Ea? between the Lakfl Herman Road gné “lug flock prings murders. e coulé. of course, have beén out or the rmunhI'}.«' or st 862 or son-E’:-hing. But it's pussihle he haa had a huroacope-done anfi usas that in connection with moon phases. A reliable astrologer, if there is au¢h an animal,_would be helpful on that. I get the feeling, how¢ver, tQ:at Zodiac may not have gone ifltQ.&3tPD1G5F very deegly. when I-raga abnut'th$ Stockton strangulation lust ?hurs6ay I checkefi the tabulation azfl found thare W93 3 H8“ amen Hsdnsacay. But later I 1sarn$d_1t'Tfl“lookeG like a rape ar sex crime. That isn't Zofl£au'a Hfla-but cfi:1d he fat? w the sex angle, at least to a certain cfiteflt? East re 3? , £455 ‘uqu --_.,._,...J,_..m.m. ..,_,___ —..—...--—.—._.—.—...-..._._4_.j,,: ============================================= ./texts/FBIZodiac5/56.txt ======= mwmH1,Hfl W“- FBI . 325 Earln E1.‘ = vgilagp Dear Hr .- - _ \ _. . ' Eoflifiz has not besfiffiaard frmlsinee Harsh 7 22. He could hava been in the Huustq1~Galvast0n area whsfie ' there have been six unaalved murfiara of f3m315$u __ l have éatsfi for only the laat four slayings ;§ub:again thay zorrslate with-the moon phase pattern réyrtéd prgviaugly: ' s ‘M4 — . J___ ' - - -“' ' Piscea muuion June 15 Golefits flilaen Faniahfld Jana 1? ' .PJ'.-ace:-9 ':nc~-:m»»:»n cat. 29 * Gioria Qonzalez vanished Oct. 28 New muon on Nov. E? Debbie askerman and Harit Johnson vaninfiad Nov. 15 {M.1 finale; fpgni later} ' It is theareticaliy possible for Zodiac to hs2a.f1:wn back no Oakland-or San Franciaab aft¢r_the Rev. 15 dauble murder, than to the fially cmplayment agency in -Stflflkiel Nov. 18 and-an gg up annngiing hcro That would have been extremely tight sehefluling-abut with Eodiae 1ittle'is surprising." With regarfl to Fiacss in astrology. I should have called it a water sign closely related to the moon, as - well as to thp~planet Negtune. Tia moan association in because of the'moon7s tidal effects. mumgrnlogieaily, the moan ia.gueber 2 and fiaptune is number 9. F159;: 13 the 12th ané lazt Sign of the Zodiac. ' ' ' And, most iap$rtant:}th2 most faVored Lima; for action in a$$rD1¢gy'E§i may extend a few days at a time, gccordlng to their “high prigstni . -it you shack ins mailing date3_of Zofiiac menfiagsfi with tag moon phase pattern, you will find that a number or them also correlate. ’ ,' L10’ ============================================= ./texts/FBIZodiac5/57.txt ======= ..L. Hm-emggap 1?, 1971 ' '.'a,e3"iés}_£-Sm st_,_ _ _. " __ - " ?a11§jn, . " |bfiUfia15_£'o_rnia “'3”- .-' -- Pleaae excuse this amateur, among ccuntleaa Ethers, _Hfqr hflrhihg in an the Zodiac case. But I helisve I have “"fin:9véred some day; that may be helpful. It may appear iuvnlved and far anti-and it is, afhrefi the Znfliac cage broke, I didn't know astrolcgy from gsterg fir numerulcgy from nuaismatista. But I cou1én’t believe that a killer fihu would take aha time and paiflé in construct hia'abstruae ciphers, based 95 his aryptcgraphic service experience, woulé be R random killfir. ?fie énnlcsed information support: that cunclusiono It could prcve helpful in several wayéa ' 1. Identifyibg'pa:t murdars as Zofiiaeia by thaifi FFUE3%qUifiE With New Econ, ’u11 Moon and Tisces Eben phases. 2.' Earrcwing his birth date in the Pisces pehiod" from Feb. 20 to Harm go, ' 3. §erhap5 samehuw anticipating futura atrikaa, although this likely weuld be imposaible Because of the wide range over which he: uparat-3.9.. Fflrhapa officers '1m;I1.:1d, be more alert: during likely atnike periods-—Just a few gfimonth at moat. h.. Iflantifying/EX Zoéiac when anfl if he comes inté 'cuxtady. . - - I h&?B lwarnad from fiigfistihg agtrolhgy magaainee that auucallefl fa?Drab1% times may extend as much as several fiays. This .fiou1a permit Zodiac. as he did, to strike a.a5y or 36 after Q EH Moon, FuI1 Eben or Pisces Moon. , ' It m&3 be that the "significant" Mh0n'number of 2, and tflfl We-ptuna '|.'.l1.'l.|.-'.Ib$"1" of 9 hsxra be-3n up-ijliefi to Various things‘; %-3’ the -29 ?91ibEr guh t L_'B Herman 5 ad and the 9 mm at - 11* “OUR hfirangfi and at E giancisoo. gut perhaps my ih3gina%iun' runs aua with me. fine ga$ia1g%3wE%%k Said that tha "ha is" Neutrne E! . \. rt‘-J-'2"-§I?31"_9: 9 should be aaaoc __E_ ___ thifizith flats I:I1_J;r- Design: 9:‘; ============================================= ./texts/FBIZodiac5/58.txt ======= 5:0: 55%.‘. FROH: . ' ' -' L ~. R’.-E.‘:' E‘.o:il;.5.:i mubcflcrg: né the FBI momma, Z0&iaa_mLghh have been :r;= qrafi by . g horéscopa nag-5-_5ine:. Thia .=__g:» car: tdbe the cansc, has.-e:€._'5:>;1 _ examination of the Eagafi no .;1.2§.1~-::-fi_<:-;3;5rr-o1:'=;~LA,3' De‘-.113; HOI"'%'.5¢GD§:(1:?;¢ Ia‘:-3-gamina cut up to ;-auto up the Zbdigas raga am mails-E to ‘-:--s B.;cI*a.m-ante %_n:u £110-3. 10,‘ 1955}. 'I checked 5’:-£Ipi.ar= fa‘ tag: '.:r.o'.vn. m|.J:1"6.{SIt""EniZII2L1'.]:’1&. --I-{:§r~c:‘s tag;-2 "t. rigger-"; ' ' . “=3 - 3-Jew Moon oz; ‘L1<=.:c.- 19‘._.2:'<_1’-',~fi:“ __ ' lake ?:Ee:r_':°:.a_.i:1 Road murders D-$3. EO, 1968- {Friday} _ lfififln-enters Z-:=di,='.-.c sign c:-E‘ E15:-as July 3,. 195 S”. Blue Rock-Eprizgs mqrfiar July 1+, 1959 {Fr'i<‘i§-';r‘:' Fu11'm6on in zoéiga aign of ?isee5 59:5; 25; Lag; L.a::_e E-»_3I'I'}'u'CISS§h :|::|.1.I’¥i53!' Sgzpt. 27, 193 (Saturday) fihw Ehén oh cam. 11, 1959 {Baturday}: . : , G.§I.i:'bi_a~ Paul Stine a1u.='.‘d§!1‘, 35.13 Fre_.:1_c1_:.mo,' Oct. 11, 1959.. E-Ltba gquent: "Zr. z-ig,gc:r-'5: Fail I«ZooLa :t.n:-. -3?: Hgrah 22, 1930. The moon in the Sign of.1='LsI::c~a indicates t‘:1a.'t.'s: Eadie.-:'::I sfign-n-born batlifacn Fab. 20 grid Earch 33 . H4; has dvoppaa ,-some fa.J_s_:>c1ua,ss to has 513:1, suck; as ma-zaini :,-.n his .435-£37331‘; Fast-9-“? 111'3$Sa;5-3 on dance: SE"..<.‘¢€!‘l'.- and ctr: rs. But. it E_»1P13_6_£3‘E- from a.c,?..C-;=_;_’I,P na.g,-azineaa aficribu "1113: ‘oer 9 130‘.-fer" to 211.5 “nu:-icr aatga or 12-2o~196a and to 10-11-1969, ' ' _ 2:. aces 1,5: called a Econ Sign. The moon's a.,<3tr-a1::5ic_=_J_ 5141 numarolc-gica1.numbev 3.5 2. ' - _ T139 firat two :nurdgz"Str§,1im occurracl ¢§F'>1}‘_f3-[E-.E1E“.‘;"3: thfl 11¢:-ct. t»w<:- on Se-.tu.r'c1a,:,-'3. Tho kidnap occurred. on a. mfieaf. Suggpsf-ing; ih-at zodiaq’; fif-':h_anc1 fl:'|JC‘?_-1'1 strikes Hem mach 02} Evundg 3:, t.1_-:5:-n":-a~;cJ on I~iund.a_.;.:, ::I?..<:.. ' 2.'<:Id\1£-.I:‘s' me 59359 to 12-}; )3! 3:23 was mélilflfi 031 1-'=’<3_ bi-9'5:-.1]. xmwéra _ f-920,5-' ::‘.¢Izl€ 1"-d.1’='I .E'v\.:.J-'\"'n cm 03'' :.ij:ccr.t. . . . : J-G5“ 1'20‘-$1‘;-Z .=.'IECE‘.5 :5-311315 3:: E‘-7:¢« C) ' 2: L .3-JOCI E-L3 [Sea i''- 15 1.3.0:! (T-9_,<-.}_... at-4'_'ac 427$ 5t:u'.§:-a-_v: a.-/I r.u:,,E an-:__J~ 5‘-'2; $(=-\.‘—'\-"H . 7'"'"'""""'""""'j1_s=¢;;, . , Jana ].CI--11 IE.-.L'-Es-.31.! E‘? ['1'!'-tr] rE‘-'w:d-‘!l'.JLI:r] 11 ['1":Iur'] '5 I'_'z-‘r',.'_! :5;-r 2::--2]. m-.~:.--.:;a,': LC! -:5.-.u] "at [fiat] 6:-B3 1fl—1_.‘-J |ffl‘-I*—'I=-'11'i.'€-‘LII 10 Ifi-’sCIl,'| 2-it [Ex'_o_.-.,'I Juno LI;-15 [:r.o:;—.=m-_-,'- _5 -:-1-us,--,-,'u 22 [#5,-,_.;_.;} July 11-12 Iffiun-i~'x:.,'I 8 II'I‘hu..-} 22 ('-_‘;:;,:=_-] dug. 7-3 IS-sit-~E--an] £5 '[£r':*1.} n::v,—:_ E»-at an-'5 ';3:.'l¢--5-\-l=s_:| -§ (3.16) 19 (sud) -U-st 14 €=n°:—s¢t;- 25:-30 [J3-7'1-:y5.F-:I 3:;-.o=} 3:5: -:-;=.-;; now. 1945 [Thur-:‘rL] 2 qmm 17 |:*.1'-.-<5} D==- 22-2:-:a '.’.._ H '. DNBm£! MI?“ .16 d-“'- 1319“ I % "L gag/saw L ._———-*“ ============================================= ./texts/FBIZodiac5/69.txt ======= 3:‘ ENCLCLSURE '_ -'-'~.. .. sugar:-If 4- ‘5 . — FILE NUMBER "' "_ SERIAL é THE an-cmsunz ma THE move was FILED IN THE 2EULr:'1' - - jznom WEN THIS SECTION 09 FILES was coupnzsszn on " -1. ~ “wk .,._\_- -all ============================================= ./texts/FBIZodiac5/70.txt ======= opcnan {:1-3-95} ' ‘ FODDEXX FEDERAL B-I.I'RE.-1uU CIF DI"-"'ES'I'[l':HA'I'I|I3E'4' FCIIPA DET.-ETED PAGE E1TClRI|I'IH.'1'IUN EIIEEIT I P:gr.-(4) wiunhcild au;i:neh- at I:11.L:. loc-ati.a11 mm file. one or mare ante {allowing statnmenis, 1n-hurt explain this I:1I=lI=1.icI:I. pf Dclctiuus wen: :na1:1& pucsuam EU flu: exmpfiuns i11dir_-..md Mom with 13:0 :,e_ga:t.g>al:uLe uzat-zr1'_a1 gu,-aj[a1;u1.g sq; relmn: we wu- §.es=t_v';'a_' 55% :§£I-as--_@ U MI!) U {twm D macs: U -:b3u:2:- ta cc-ymcan D -:1:-£2} I:I cm] H It-3-mire; E1 M1: _ :3 (ts:-mcrru ' :1 mm _ D ran-mn:E;» I: cam _ D {bJI;”I'}[E U M43 -3 tb]|(“3' :2: ca:-us) U (km- I: thus: I: ch;-:9: 1:: mm u may :2: mm l3 Iaufumuatinm partainwd ml}: to a third party‘ 'vs"uJ1 no rcfcwucc 1:1 U3:-. subject at" 3"-31.I.T' rsaqu-35:. or the subject of ma: E'2qI.i<.'.sI: is Li:-ted. in the tille only. U - Dacnmlents urigimwai wi'J:u a.ncI:ber i.s_1<> hr: used fbrntfurmua regaafling these pagas: .qfirJ» .-H Rug-5, .-_..,;, fin; g:r.a.r MQXKXXKXKXXIKKX3 X DUI-St-Ed Psg¢[s} X X No Duplication Fcc X I EDI 1EIj5 page X PEKKTXPEXXKKIKKXKITX. XXKKHK XKXPOQK XXXPEKK ' I-'lJl.I'D-CI] ============================================= ./texts/FBIZodiac5/71.txt ======= _. r5's:.;:-;"'a:.rr.-_r ___,‘r/,5-é’__._€;. :"_,?Z;'.«:::£*;.'«__. _-._-.-. ——-7'5 —»— -:9 “‘.'L .. .*f'—“.r¢*é: "-‘:3 ._.z:. ¢«. .. ,?__.,_m/}‘é9-.-.;a’_'__{:7 54 "‘~"—"-"1l"L}'5-5-..._'1;L__aC{‘::‘:'_“'j‘f¢:#é_";‘;,'l_,__a:"::Jy‘iz1‘;;Q’:_ -;_ _____ _ 5%-%'_:rM__'z{-=_rsn_.a_L_ . % : .4 _.;f.“r:-._.__ ; : __ -_.__ ‘L M _ f if.’ “:77 ’_’::::”_::'_'—i_ ============================================= ./texts/FBIZodiac5/72.txt ======= zunrxxx 5’ 5} Jnfinacx .;num!.L1mI1£.!.IJOFnrPE511GAn{:n _ ‘ix nqqgmnuumkmnmmmmnumpuminfimpdhdwwnhmmgzcgewlcmuuwianflahbmr uzlgezasaewyuu. ; a Mu _ . :3 {ErJ{Dc-‘J I:I <-mt-'1' carancaq H_t';-_t:o1r:.§::.-'._ 'E'I:e5e1'_1t?-_ invu-,$t1g'&tion'_ah':fi'w§; _ _ __ elratrorxic technician a'sé1'gru-:d tc'U._ 55. 1\Ia';;-r'-EI,L]Jm§1j:=ir1e':fl_u1E;.r' anu:1_~ __'.{' imdé‘ ?m::'nE.'_$t' 19.-\=-Eff?-fctis-‘$13 a‘-.-']:-I:-'o}tI-cf ' in f:'o'gI"a‘-:-Z fi""té<*}E~=;§iiE1i':1?§;s‘ __ . . _ .:~-.—-« 1? f EI.i$-:s'.'.*é3*:.*' " " --1r'€-c[1j;*?‘5g"§Q1.*%.-Eo=. ============================================= ./texts/FBIZodiac5/79.txt ======= E_;t§aLnla1_§}_§9u requested: D-:|cLune:11: - Fi2!.1.g&_Y_'PI'Zi_'1'L:E D“m received: 3"':L1’r_-H _F'.e.-,u1lt of E::111inat';€-'11:' ’ ‘H " _ " "“' Exanjinafiufl Hr‘ I _I.I_ hi-";1;1I,;-:3‘, ;..w. do»-=~+¢I—‘ **:?f‘{i":::IJ 57C’ M;,,,..»: WM -1:33 Four: pagea of lined paper hearripg known lfliflfl handwriting of P.I|2EflED' HGWLRD PIIOHAEL ' gnmfin E?ID I gJ % 2 — Saaramento (9-53) ,.’?’T-TC‘-H"4£*L ;|_- ’,;-;;.-..r\ ff’ ; 7-2 *"" . f i»: I. - .- - - Efiuznnu BUREAU o1r1Nv3.~3*raG¢T1t:rI:?“*% RECORDED UNFTED s'm'rE$ DEPRRTME‘-Ds'T OF JUSTIC 9I12f?2 alf L.u...,.,m, wmu 51.“. H0 ME FILE; ,? REZCIDIFLC; . m.=_.a+ xxx ~a—L+as11 '/1 /%*‘ EXTURTIDN _ Ln|:u.# |:+-'r2Er£J.1|351 L-L : DD: Eacramento. E1-*=“°311Eti°°TE==1“*=5*E==l hr Buffalo {EI—J.lZ|15} aixs.-t:-:1 BJSN2 ============================================= ./texts/FBIZodiac5/80.txt ======= mg ' '_ :3" ‘5¢T"""'“"...M.;-..(. ii‘; ';fE§i’_-iizuiiq 7".I_i:§ ' . Ir ============================================= ./texts/FBIZodiac5/81.txt ======= —.-o—o.-r-no-m-— F5" ': CHM‘. 542-$4.1 ._ Q" @ Data = 9,-*29r'2 DIRECTOR; EDI (9-£9911] EXTORTIDN ._ OD : Sac; amento .2 4* '3_'i"-C;L2|13I3=e.I.’.‘ E8 Buffalo airtel to thé . _1_:u-wing investigation was candueted y 53:, AT SAN FRANCISCO, CHLIFDFHIA ' . On 9/1,2,=':2, i:1iaE: -‘San Framnsco Police Department a ‘name that a search of Her files failed to dis close a record. for RICHARD H0‘?-mRD MICHAEL, date of birth 3..-’-fig’-'.11, Ififiowirlg investigation was confine-‘.26 by 53:, AT OAKLAND, CALIFORNIA Ha‘-ilahd Po 1 ice Depa rtment fiailed to flisnlnse a record for RICHARD HOWARD MICHAEL, date {hf birth EfII_.J4J.. - San Leandro Police Department adv-' a 3 geaxgh of. Q)‘ Bureau §£c4l:- it - _ g :1‘ 2 - Buffalo 2 [SJ Approved: 5%}: E 0 I9.72;fl I; f Sent _ ‘ 3!?!-EE-"H13 1"‘-qefft in Charge RT SP-N LEANDRO, CALIFORNIA . oh 9/21372, t9—1D15} Sacrament-.0 [9-ES] Cisc _ f?'_'ry-1 in pm-I'n£-xx! or -rad?) sac, sm Iéasmczséo {_9=229s3- (F1 on axzvrz, 1-{rs at V153 1: at a Search of her: files Bureau, dated 5*-.,-‘Elf-T2, Identificat inn B_L1L'Ea1.1. I den ti fie: ation Bureafi .. Idantifica-I:ic:«'r1 Bureau , her 15 US’? 319?? -nu:-c-I——..m ]-.-E P-at u. :5. covsnuumur pa-mrme |Irr|:I_1 -n.—.::=—.=.: ============================================= ./texts/FBIZodiac5/82.txt ======= <"_""‘-. L. '--:'fi]_e5 failed to-dis.:'1osa"a_-r-#1:‘-érrri for Rlcfiaflh HDWARD MICHAEL; date of birth ax-U41. ' ' ' '- - ' mama A:-in umsnnovs ' «r’- ~ _ . = __E ‘ 2 ‘ _ «~ «~7_;;_ , ,-..; ' W ============================================= ./texts/FBIZodiac5/83.txt ======= ============================================= ./texts/FBIZodiac5/84.txt ======= - ' ' QDERALBuaEauoF1NvE5TtaaT1;::}Q I J -‘ 115353533‘ . 3 STATES nnmmmmwr 01-" Juan ‘ ' 2 - _' -. 5:11:72 :1! . Received 9.729! ?'2_.,_-.': 'Rec:m:'d.e_-:1 9x29,-W2 :f'2";°ia°lf”p"r.‘a'{.5"§‘5. nu ma ‘HLE He: wants; . ' - . mg as me: 2-«xiii!-ea.‘/I5 £- 1=?:'£4:*P-'1’1¢_N _ Led:-.-‘-* n—1r=2:m_1.1'_i:n51 LL . Lr::#A-1_m:+42 -' " ' GO: slag:-asintu '**"“‘"““*i°“ ''*‘1'**‘-'**''‘-“‘‘ W B!.:Efa,'l.-n ca-4:153 size-+:a'1 nxsme .F=,=r=\'=li1?.=.=_*.i.:==1re11ue-sted= Dosannaent - ring-gnzprinzt D” "°"“'“"°'“ °'f.§é{?* ' 'Reisu1e |:IfEd\1:l7:':§l.'I-‘l-U--B.{-'.-|._B'I'l:_ " ~— En=iina.'1i°n'1=$3=l.='tr-. ‘ 3-=mefi £_=us'r'=ect'= . . .. - ' RIcH.:.1§:n Human MIca.AEL,n:1£'.: Bf-H111 Noted by: ' .-urwcm.-;~ Q‘; L‘??*._.-_.. ‘if ‘V qvfi M _-,'42- ..'I'-“- If -I -_ " . F3; I ,;g,g',;.,=_r ,t:,.¢?.;,Za€L;¢ mm p’ ;=.=-95 I” Ffjjflm ?,.gM.W.'_&4M./1%“ *“*“"‘“"“""‘.. ' “”’" *‘*~'~~=’=e- M: (En .;.e.*..£..-.;a;.a°:«.eJ) _ . rm;"“‘*'**‘ °?’ "‘” "“ "‘“*'*“*‘*’“‘“““" 35*-°‘”3*5 Avid" H11 {Eur as of :11:-uni-1 Enpir bu-'m1g3_5 iuwwn nnwnnmmnfifiw I — fiamunm-bu {sun} - J F-:: 1'0 - 5- Dictated ,-'0 ~ .57 .72 J-Z.;,_C#_, Time Date Date , X-=>»’r 7 "17- 5-Q’7"~4'j»‘& .#.:‘.*:T-'r::»’/,*/'«'3:-r='__' - ============================================= ./texts/FBIZodiac5/85.txt ======= I:IFI"_'sfu.,.‘v'_'I.‘:- ([2-3-95) FEDEBAL BUREAU DI‘ FEJIPA DELETED PAGE HON HE’? INVESI'lGA"I'IUN }i.PD§?'{I'§Z'C DUQEXKK. XXXKXK Psgefis} w'LfJ:n]I.c[d entirely at this Jucstion in the file. Um or mm’: ufthe following s!a£e:rIrImt3, when §ndi.cs.1ad, e-rpiajn Lhts dcletiiuu. C3 Dnldiusls I-'I=n= Jlfladfi p‘-arsuan= to the I:m:I:-.'q:It5<:tA:ls iudicaxud. below W'L1.h no snptgablc mer|.cI.iaJ available fol 1e:Jr:as¢ to you. C‘ '33-IIE1}' El El tbfilfi} IIb)[3'} |I>}'[4} IItI)I[5} [tl}'[€} >%.i3.','._5fi3. EIUEIUIZIEIDU W-*’.'7J|(,-°~JI |iTr}|."UU33 L'€*}{'7J(CJ ¢'}*.‘7}CDI' ‘I53-1"-"73"?-E3 |ilr}|.“U|.'F'3 Wis} G1}{9”J Sectlun SS2; WES} Gilli?) OCIIE1} W93} Gr.‘-N3} UCJIE-1} (1¢I[5} C=C'E6J MW DUEIEIUUICIDD III mfurmmlon p&:'ta.i.1:I=d oI'JJ;(1cr a. third party wlfll no I-s:‘em1.o5 =.I:I the subjam of you: request ar the -slabjsnt of 3-r<:t11r n2aq_ur_'at is lia-ind in flu: titlc cmJ3r. El Dacumenbs crilglrraled with amthear Govemmeet ageucrfits}. Tl:-Est :1u=u:m.ru.s were rcfcrrud. tn that a.g::ncrI;'u:s;I for rs':'Emv and d.1'rau:«1 response in you, Pagcs :n=U:z=i.rI. iI:I§I:Im1aI:i.n:In furnished byanmher Gm.-Brm'nsnt aga:Ic'_-.'~{'Le-5}. Yen wlllb-3 a.d','L-sad 1;IyTJ1,e F]-BI as. in It": I:cJ.r:a5a.bi]':U uf Lhia Lnfumufiuu fI:I][I:rv!-"Lug uur om:ssuJtaJ:'LI:uEI 'u5"LrJ1 L11-5 uttm: agetlca-"$515). 1"‘3,g€[$) Wlfliheld i.11.a.Sm.I.IIJI. as a. final J:I:lI::sI: dctcrnfiuaxiun baa nut tlurm J'El.3.|3.B. You wiJ] he aliwiaed as to flu: disposition :3; a la‘-ed: -dax-2. -3 Pages warm mt oc:u:sid.e.-mad. for release as the-;_v are d.I.1pll<:aLiw: of ?' ffE?.I'f a! Q $35 § 3 3 Pag¢[s] w'L1J1hsld fur the fo|J.cwrj:1g It-asmiiahz II The fullcrwing I1u.11:IJ:Iaa' is to be used 501' rafsmtcs fl:Le:se pa_ge.:.: Xfiflflix XXEDCKK XX.'.9DQ€X a. smear» 11$ _4.,,.,, 3555" XX IEmXKK X Delztad Pagznfi} X I No I:Iuplica.1iou Fee 2-: X Eur this page X IKKKXJOCXXXEUQCXKX E1-'00! ============================================= ./texts/FBIZodiac5/86.txt ======= _ Ca-4~iCiCii1~ 11.57 OH I] TO Wmfilé Q98-H FEB2Ei1EJT3_ 45>-5?-3 ============================================= ./texts/FBIZodiac5/87.txt ======= ============================================= ./texts/FBIZodiac5/88.txt ======= -u-.—.--1-u. rem m. to .--- ww use new : - =amI-in -ac-u-0 III-II-I _ saw‘ - "_-"r-F UNITED STATES |I.i|..3|VERNMET.l' a Memorandum . M-A {,__<,_.______ _i ‘-2 I In .- ACTING DIEECTCIR FBI {9_-H911) name: 1:'30!?3 3-,_=::) E71“: (Attention: Ffli; laboratory, Identification Division} 9: g‘J."‘ AG, SAN Fmstgggsco (?n~30E})-_ IZ_PI'__ H _ *9’? . ':332as_1s3 ELLEGED H C U3 N U2'TKI'ID‘i~TN . GDVEEMENT 'RESE?J.7$tTIDE'I --1} “fie '- ~. _ I2:-:}_:‘__S.-!x.a‘.‘I_FE‘..~'.\.T.*1-CISE‘.1‘.2I - - _, -c;_" ._ nu: ' ' f ' ~ ' Ln-'-‘-H .EX'['G11'i‘IlJIE ‘:_?’”‘57‘_’?’2’ ' - m:-sagmmxawo F E ii’ _; ""_':' Fu'r_thr-‘_-' ' he £1.1.a:'ea.u.- ms 1'1:-"‘3':'1'72= ' - - ' -_ cm Invgstigatg Presirliu sf San F1's_1:L1:15t’.'.U,-5 _{g,4§,Ca1ifMt1ia, had racexve 1n arms (in from UUTCE -it the 5 :.-n."+.=I. -w:._r:<1t1cac<.- I i --is-iei-ra Army Depot that captioned Subj ecu had dissusssch »’ ’_?_= 9 _\réI:__!_-_h,e 1_'|]1_]_Ide‘,l;‘ uf an unknmm Negro female wit s BGLEICE. I 5 , E -, ' Intérvietqs to data have ‘seen rteéative. ha‘:-EVB1“: - ' E: ‘5 ‘h reviéwing Subject pi-gotngraph with artist's‘ :'.Is11- ' 1; ‘' Ti _f_E_pg-ion Qf U-f|_§u_b 1_'|}1_]_I are: it was détgrmined that there is _ 5- ‘M. .,;- some similarity between“ photograph and the artisifs QE i . conception of Zodiac. . i The fnllciwing in bsckgrwayld inforrnstiafl on ‘CD3! '53 — . E §?‘L 5:32 of birth I? - 55»: __:,f*'1‘5i£.?.i=’_.s._- Height mo? §=,::c:-:s~::ED ‘ ‘gem 551:.» FEB 26 1513 3re.5- - Scars ' Fingerprints —- Bureau ' _ ' _ — San. Francisco - - _ JR 331. - 9.2295) ‘x ._ - - . . . : s .. -- ' -+ -2- 1973 .”*%'_.‘“’;:"i*i**:%i.f°:°fi’~f_Ef%3f%'f?:”£3if%t'i*W7. ============================================= ./texts/FBIZodiac5/89.txt ======= SF TD-30?} JJR:dd5 II: is requested that she 1a.bc-raF:u:uq- compare : ' -=- ._,E-;:dia.1: with known fingerprints ft-_. bqbof "Also compare. known signature of ngerprin cards witli arleged handwriting of - and ac. - 35;. an ============================================= ./texts/FBIZodiac5/90.txt ======= 0 Human 0f_!il1:ff’f|E‘uAII_I}_|'_I .;:_:. 2053: 310 _, TE. ============================================= ./texts/FBIZodiac5/91.txt ======= u. I-as--!a.cv—l|-E-‘E-3]‘-.— ' '5" . f FEDERAL BUREAU CI?‘ UWESTIGHTIDN LATENT FINGER PHENT SEGTIUN WORK SHE ET H-‘W-“3"-"'35?"-‘= 2.;-"5./T3 ll}: 35 am jaf Reference No: 9-2296 F“BIFik N0! 9--19911 HB€E'lU'Ed-‘ 2/*5,-‘T3 Laban: Case No: A_1a£-'42 -“Les-ver lo: 51'-C, s.J1'!_P'lI‘a_I1|'.'i_SCUJ -I '- .- - - - . e __’:?E:e;I1iuo:tiun requested by: Aflaressgg Copy In: J “HI-:i_ 'q:1:.iIm-‘.‘- - ' " -- H ' . ' EJHORIIDH ‘ ..gu_tf! of reference communiceuon: .a.j_;,—|;eJ__, 1,u’31f73 '¥«"55?'9”'6=I3Ta~n'n=_-:3 5 I‘ "“‘ C l ' unie. State j hyfai 3.4-» J ,r§§ me-I ?2~¢7»§rmB= Flesult uf examination: ymm ti :14 e mm X, H L, man e:~«—{-,7.” Mer(;‘<»’Jéa:¢»»*"--/’ e%wW/fl~ fixwmée; J; .4; e,:;€.,,,eg,.,¢:.’ .,..L‘;.m:«;%~ cm? ;.gW{.*fe£:}£i?e ‘“ Exuzninution cotnplgtgd z *5)“ E "”:»_‘f.:"’j Time Examirmfiion by: ' 7} Dicterted *7 )5 J -2- Der ,- videncq noted ;"J‘_:':- ' E? $; E/‘Ia--/,1__,,,':;’,J__'..__;;n.:¢_~: '_,.e4—¢?ff/ ‘W_._,-;Z'2_/./«5«’4'z-in’/-¢~*-;_:e=-=9: _/ W2:/;,,W,, ,»g,g’.,-zwv:L-‘$-/r'/’é“‘»7;‘}'n°'/V Y. Q . =:~,~,,;:"%=° 5 afé§~s{~ré% ============================================= ./texts/FBIZodiac5/92.txt ======= ============================================= ./texts/FBIZodiac5/93.txt ======= ============================================= ./texts/FBIZodiac5/94.txt ======= mcam (12.3-965 '- ' KXHKK XXXXXBC xxxxxx FEDERAL BUREAU or l1\fi"ESI'IGeL”I'.[ON F“OlIFfi DELETED PAGE ]1‘|T'ZIRM..-1’ITE3N SHEET f 'Pag3[s) u-'il=.i:IJ:I.e:l.cl e:111.1zeI*_'( at fl1'Lslo-cation. in the file. One or more of the £0110?»-i:tgsta«‘sELE:n15, Wham indicated, e:tpLai|:I this dslctluu. fl Dclcticlus were made pu.1'$u3.CIt to the czmrnptluns Lndjtzstvbd E‘>t£:l0W with no segrerpbls material available for ztleasz to you. Svatctinru. 552 M15 5 filfbfill El [bJC’:‘}I.'$fI 5' '{|iJ'I5}' D flit}-€323 El [him-[E3 El {DEE} El ftI}t‘33 .¢ El [bJ':’T,1[CJ |'_'| '(kJ'I1J _ El [bJ'1‘-DID) U (kit?) _ '3 |.‘l='II'lT3'3IEEJ- El -(kill?) _.., '3 UJJCUEB III ik.J-(=1) U UIIIE4} U [bJ{33' U lkZ|{5}' El tb}f5} El ibJtF3' El iltll-{5I' El rum} :1 (km U I.1:.f1JrI'It£rtLt)ett parts.‘-,o2:1 onlyte 3 t|::':t<1 paw with no refmuc: to the sut:-j-wt of your N-gut-at or the subject of 5-‘taut reqlmt is listed in the title only CI Dusumcttts odgiuaxud. with a.1t:It|:It:r Gm-nmmtmt sgcmyfiicsk. These documents 1|-'|:|.'l: J:t:£¢rrt.-.\:|. to Lhai agr:tI.t:3*{l:';:s.) For mt-icw attd. dixtn ttzpustsl: It: 3'Uu. Pages contain infrxtmallon furnished b:.tan1<>1h.e-.t Gevetmmnt aa°—“E|D'.!'Ct6t~). You wiJ]be aI:1='Lt.t.ui b:.tiJ:I.e FBI as to flt-2 Itlemabluty of this éniortrtatitrn tollcnt.-‘Lug Uur cc-n.t1IJtatit-J;I with the other -ag2v:Lt'-1r'{'Las)- Fag-xfigb wiflgbald i.DB5IJ'l%J.l3J'l at. a fins], [B13353 I:1t.te.11:n.i:],a1ioI;| has not been made. You wi]]5;|e advised as to the nii,t,.j|;It;«s'11]'vc|rI, at 9 lane: date. Pages were not cuusidersci Ear I-sleaze: as they are liL|!;l]il.7.'el1j'i‘l3 Elf Pagttis} witttbeid iurtbz Io.llo-slug teasw:u[5J! K 111,1; Fc.|1¢-w'uJ_g number is Lt) he umaucl for reference regardim-3 ‘that.-2 gagut _M_ 9-¢{'?'W{~.r?0 $91 {EH6 ED§P=IXXK}C}DGQQ{X§{K X pelt.-bed Patgelsil X X No Dupiicatlon 1'-‘as X X ft:-Itltiapage X EDEXXXXXJGDQEXXXX X1T=2}DQ§ XIKXXX XIIDDEX FHIIDOJ ============================================= ./texts/FBIZodiac5/95.txt ======= I : I . -/ . ' ' . ' =-+2-=2-cw‘ ‘=-"' “'23: a-azfinwr .';§@¥-<:=%.“fi?"“ W ~*-==’—. --r-~z:=_ ============================================= ./texts/FBIZodiac5/96.txt ======= ============================================= ./texts/FBIZodiac5/97.txt ======= ============================================= ./texts/FBIZodiac5/98.txt ======= .. . . It was an! atarmihed na.*aa’_s;;*_€zc+_I:1a:;r:';'_-:_.*.Ex‘J:~:JP,;:*:o — §£gnificant?nhqvacté' Q¢3£"'-"'a3'LdE{Q::E :~'Iha .;':_a'a33?» _ _ -...w:_-_1t_a:.= '::rf__1‘.t_s ,~'1-a*..'1:»é.~s-s;§.-5..-£2‘-.~a:ta':='=._ E_£‘J_DIL¢-.t'.i_ _ __ :- '_ I‘ " '-" " ' " ré ;;§:=.I§ar_ad y“ t'sa.:.;u:'sj gang; '.;:_:_;;1j.-mg .- kn -- __,3-1-'.xv ,_ . ‘ ============================================= ./texts/FBIZodiac5/99.txt ======= .21. 1. I. _ I. . 5.; - w‘. éU“1{fluplNEv~¢.YORK S’-‘.°.TE POLICE -- - K‘ -_' star: Luann; rl *"|:!*¢.'!!"a.1'.'- ‘J’-I Hint‘ cg. , '- - - ' SC?EM'|'_lF|-: L;.:',a-:p|=:_JI‘TGFI:t' . _ ~ - -- Hucjust 3, 191': " ' .--~~ - ?305nn*-19 _ _¢ H -1-EEDHIIEI-1;‘;E-IHTQ .'(31§_r1_enca M. Kelly," Di::e_<:_t7q-;:__ 1’E*~'i-&:L'El'T. Bureau Of Investigation .- ' ’ Ir - ;_ Waflhihgtfin. ma. 2:535 . --=’£'??tcH« +:?f'.-' T’/-—__;‘-"(jg ‘31_€“" - " I‘ - _ xi-in-.1-i.:_.'_,-:,__J Est":-.--.:.:--311.» 5'‘ ‘'-'L'-‘ "‘:'."'_"'1_’.FJ".'?", '2 1J_ear Mr. Kelly: _ M , _ 5_ ' F-\.f— 2'? L ; Enfilc:-ée-G is -El copy c>f'a1‘:—':1a11:.:In3c1ncIus letter I‘-El:-E:‘|_vé'_’d_b5-' -a ' ' Q ' .J.0c-:31 newspaper. PLea3I=_- process through your Ananjnwua and 0.2 _ ..':;;"J:’Iw:ea_1:n=_-ni.-ng. Letter 3:119 am also your ;::rg,a'p1:ug::'aphy_ 5e’c:ti:In. -R-&7que,5t__3gc:u pl"-3-age expedite this matter aina .3‘.-1v3_.5e pncmgtly f anal},-sis. ' ' ' 5 in n:e.rE*I|..y_, Diu-I:d.:n1: '." ' * ' " _ _ an wr:I.1.'_:L1:ng 2:;-e-rt Enclosure _ ============================================= ./texts/FBIZodiac5/100.txt ======= agmtifiil . or .-1§d;;.3 Wuhmgton. D.-£3» ~-éiifé rznr 11-L . . ’,5,.—_':-- -I .. __,I-.,:,-_:- '- ‘3 - -*5 ll':J_E_'f_lT'li\-'lIT;;I1_'1""l__ rL_£.¥':I:_F_J''«|_'_|'_f__fEl'fG_']-f'F£ \ .. ~ ' - . " THI3 RE-'F'DR’J'.1‘E Hummus 5'0-R-UFJ-"fl'3'LHI.._'(:lSE o.nrLfr IIl.5iILH.DCI-MI: .-r5La:1"r:?5lrrIT‘1'|:| ============================================= ./texts/FBIZodiac5/101.txt ======= - 361- A1-zrh.-v_=I ~.. 3515. I-Int!-lg T: E-lI=.- HI.=I=-I_= "- JIADHIN-IISTRATEUE PAGE ============================================= ./texts/FBIZodiac5/102.txt ======= ============================================= ./texts/FBIZodiac5/103.txt ======= a-run. 5-um us. In _ -wr Ilnm-mob _> -:-In It-we (H on) pan-u.- unrrso STATE5 c_7_ -nqmwr élg Memorandum To ‘ DIRECTU, FBI (9~499ll} DATE: liflfffi -sm, siosmsuro (9-55) -{£_‘»_J_ _ 5UB]EUt£E ' -v Z'3D'I.|!3;.‘-3 EXTBRT ICIN _hh_ Re Buresu’letters to fiew York State Police, fllbanj Hefi;Eork, 3f3f?3, andmBf1flf?3. H__ - '" It is noted copies of referenced letters with photocopy of envelope postmarked “ALBANY, HY LA PM1 AUG l9?3“ beefing hand printed address fTH TIME UNICN, $l£eNY, NEH . ( YQRK 12201" and accompanying hand printed letter beginning -"You were wrong I a...“ were furnished to the Saoraento Jix Division. " ' Un 3f16E?3, copies of referenced letters and enclosures received with referenced letters were furnished - $0 the Vélllejfi, California PD slfld the Solgno County SC! ' Since both of these agencies have an interest in the Zodiac case. Dn 3f1?f?3, by separate cmmmunication, copies of the above were sent to the San Francisco Office so they could be furnished to the San Francisco, California PD and the Nape ¢°“ntY: Cfllifflfflia 30: Since both of those agencies alsu have an interest in the Zodiac case. Du 8f21f?3, copies of tfie ebove were furnished to the California Bureau of . InVe$tigation inasmuch as that State agency 15 also interested in the Zodiac case. Since information received by the Secrmento Division has been furnished to all interested agencies, no further investigation is being conducced. ’ REL!-3 gfld /.I 7;: cs- £5-11?»? ""' "" ""“ 5 l - Sacramento :2 N0? 5 W73 1 2%?” ~«::'/H -— ——-nu y H! 15:: $5 re ‘Hex e./ - — . T H ' {PJ% £J -30:’-% Rsgariarijl cm :5: Pajmif fmvisgs Pier: -: -2' ============================================= ./texts/FBIZodiac5/104.txt ======= .-'I.9'1:'.II:, E-|:I .._.. I - I‘x~[.x-fi.5_}.—;-'uiru,_ D::p»r.#x.I}.«Inv.,_“ .-‘u=9—L U'L.'.'. Admin. (T C-‘tun. B1-'52. _ Ext. .P.[I$.i,l'L‘§ Fiim 5: (Ben. J: I1!-mi ..... _._. '2 ps>+:!::LII:1me1=-3-1iIrs1151Jn:~I*ec->1 _ ‘:9 D $HCI!Dfl '*;#' rzsun9?4' j I. % % r % (:1 ; NH £fl£S_SF FLRIHTEKI -. . W G-‘I _ 11:15?!-1 I-i'1'IEL I-51-Tel can - " ._ DIHEJJTDR -_éa'i:'jz;!'¢r~1I»_::4T-1:} , H L _ ' ."'%f=:"_j1'E::'::3s_oi'::_ cs-229 65 I 3 F"-.'.'.3G Es I- ... 11:53:":-_'l.'t":II: j_,,_,,_ '_ :'z':é-3|. ____T__C Ls.L=~=~.'=w.':r _. l‘!:.\15. fic Et'9.|._ _,._ -She-:. ]:n'. ___" . Tvnigjngz -_ {anal CHII. _'.._. HIE;-It-5fl:; "Km. .... EIi:a:tn: fiat‘; ‘flu grgq u , no = 3. 's;.':;m_n-1m«:rc+ _ "n _'*fHis nus, I$5E1=_'fE;It_iIF_Hut11cIDE - _ "H I ’3"__i'm:.ug:_s¢n-'-:'m'LI'5cf 'I_:'i~:1=_m2'r:~1i:5buT;.s'.::-u;sz1:$ ;J.'l-[.b.:'_1' "or": _ - 3 7' _=' s_i_'1f4: THE -'5.:,_a3:'._r*1a7;:.'r:ri:1s_::r:_.§:£a}g'u:-:i_q'LEj'_ !g|.«‘*3'|_v‘$!:“_.§_'f."' I In . L. f,.':HAr..nF:{:I2 .;coi_4FE1=:1=rIa1s= wmr A HANflu:=:I11Ha'= Em=z:aI._..1T'Hns '; .:I:;;§_§:1~f1;gg_fi._f[.fiL§;1":1'i4E r«ic_rI£ was in Him FR-_D1'i zobiflm: IFRUM I ' I I I ’m-:- tax: or In: ;.x-zm-:9 _ .::c:':-1;-'.;ra'1'_s_2e:':_nu..:e1I:~: Pnzuzuus LETTERS. _ kE,,m1,wEME __ .. . EET >' . _ _ ============================================= ./texts/FBIZodiac5/105.txt ======= ~. Evaefl-Iain":-.-=:* ' ; 55:--9-2295 - -y.1:r=fr*e:_1a;7nEfiLan-.a. whme jndjeaabanl, I:eqI]aiJ1 l|:i.:- dclctiwom. If 'Dr=|%'rim1.3 Wm made purauan: to tht rmcnaptciuua 1'J1|:l.i:.a1I:d bflcrw with no -a-:5:-zgablz material aa'ai!.a.'n]E: Eur 1'eJease In .='a"-1- -5'-zctioui 55: Section 552:. El (15-I'|§1l' El {|?)I.”?J{-“>3 III {~=U‘{5}' U MISS‘) U {b.‘JII7}{3) U f.i)'$1}' B G=')[3) U {b)I.”'J‘}'{'3) '3 {l::){1I' F 'f|='}I.”?}{D} 13 {EIIC-13' D lib???)-{Q U {kI"€3}' _ 13 {bJ'3’3'}{FJ El L|~IZI{43' D round: I: Gupta: U was} '3 |3?}'i5I' U {EH9} U {km} '3 (W6) C‘ f'<}£’J‘} U ICI§‘-‘H113 mu’ u:IJ1sult.aIi.oJ1 with the other agsuc.g.-(1'e.5)_ Pagata} witbbaéd inasmuch as a fit:-a1 release data:-mJ.nau<>s1 has not been made. Yuu wil[ tn: afiwlsné as no the néupasifiun at -a later dam. Pages Imam out -wnaldamd fiaurxalease as 1JI.e'y a.-me dlzplicatlve of PEIgE3:.'5.) withheld For 131-: fofltu-wing ma.aUUIIa_',I: D5 '|.'.|I3c fol1m-ri.11guum'b<:r LS-10 be used for rcfczaaoe IB=gaJdi.11g these pages: 9" "I"‘?'?H-' 1'".-'3 Ir.-:9-:1-.t.~« H" “I-"4 7 JDCXXXJHHXXJDEXXKK X Datatsacl Pa.ga{.gj X X Nu Duplicafiott Fee 3; X far this pgagr. X XIIIIXXXXIJQDEXXK KXXKRTX XXI-I_TIi'JD§ 2=1XX}i'}D{ - FBLGJDI ============================================= ./texts/FBIZodiac5/111.txt ======= §=a'mu1s:_{u'- -ta"-15%": s_1-- __ _~.,__. . ..-\- ============================================= ./texts/FBIZodiac5/112.txt ======= ============================================= ./texts/FBIZodiac5/113.txt ======= -43-!- Tvpg L':ny|‘.n_;:a;e~s:!-n-r I:'ud'c.J_ 3'.- fiI§—*ll'."U|,}:L-.-' I - ’.- - ' ' ' " _- {Pr:'a,r:rj~J__~_ :' Ifijc1daed'--.f.t5r3:'IIh '=' 331*‘ %::tI-an-Es:-¢1:I.'-' .-*'spe'aiai_ .Iig\en_t.iu Ciiufgq: ;_ . __v_‘.\ _ J_. . ============================================= ./texts/FBIZodiac5/114.txt ======= R—' 4/£1‘/,7 L /—‘e~fI<'“ Jf!"|-Fl /17»? F -;v?4’¢/ 2% 97/ 2%.»: ,5/.aM.a:r gzrfiffgggfi #7‘; -W’ 5: :»:a-?£r'»w” fit? fem :..W,M’ t:.:??£' A @9943: 53*‘: sw1 ‘P’-3}‘? {~=‘++‘/;--zx—-n-r_ »: ,3? gmfiq I __ ' 1./‘..Zu=--ail?"-=;.r;" at «« a~mé'.~»_} 77; ,éx-‘mt’ m;»s;.~»4,,4.)L. rm" *3“"’:5*‘ -1'r6"+«»-'== J".-'3-crc. mm-=. _;r2e=;w"-5;’.-_ 5:)-’_¢r.1-?"rr_,.¢'~,r-r=.5m§. /Jd'n-_'—'\-6'3" qua!’ J-‘I-" x='=~a/m»#£»z’_ 7:»; 2:; F5? WMM 3,, ,,,,,,.,-my 7:, 7g"“"“““‘§ 7°;-— ‘‘°‘*’17£'J''5‘'‘'/ % 5‘:-*'5.*;r=~:!s?5-5' 755' R"! (‘rs-6°/« W!» in: flaws? fled? , ,4L./+..,i,¢.-;.}s ,,g.§_ 6.-ERIE" éfz. £-<}¢1-’42'»zfl;-cw" K 59;“; ‘f;.?r,g_,.._|_-1_(_[ ""5"C_ :51. W" / 2-’: ?'—:wJ;,-q?4:1,;;:£;'l*? ?.«.e:r‘a:~;r‘E.. ;,gu.._ ‘,£_,.,§. /3,5,-9 ,z_£__ 9‘; !,?i'.:-22 ~97; ‘ era’:-h-_¢-I‘é3v’*‘.r dud. .st.";J/..:a.¢4,r.£,£,_J av-L. -“F-v°‘H—}?f;u..'r’£z;EnJ é}-4JE{7"1'?;_ If £;~—.n-":3. d"|’_.— Emqlfiqm-qgajjf ';r‘é_,’ /J‘) "§’{===-c. I-I1’-5-':.oIJ /fifiiéfijrj ‘.:-/—:4,r¢__ /14;.-g,;;i.f,,5.4_{_ fix £72’-5,.u:m.uqi;.a._g_/'r J__._ JM,_,4_:'1 £?{:_'_?. rcnziél "'"h'.'.- 5'-H.‘-( 2&7-L. ..&z'.'¢"':§L_ Cg} /§‘§'~L— .r.".¢1'*F5‘:re‘1=:'_2§" gfaaé .«;n}'f»..r_ .;M.,,g,’;,.,E’ Fifi ff-1: /Vii (‘cw {é/efgggqil ;_vL«:»—- flu, ,9; ,,/.,4v§4»..5. (;,m.-Q;-‘ ‘g:_«_L_P F9‘-"C3i?” -H-1 ‘,,,fi=::a..,> K//J #31 ?gf.,“.-_,{, Kg; )?‘§-(¢?"'/§.¢~,£{,¢.“£2r'3-.y{;gr‘(,;§31.a;;;:-?'£__ £-'\.. ,§3$,-I’-=(:‘;.. ,.-"M-'2/.;:.;‘t‘u.-* NY ============================================= ./texts/FBIZodiac5/115.txt ======= Wmmm '.}‘ " ’-..''-J ' lmzxxxxx mmnux. nuamu or iNvmnt;a.TIoN mcnm 913151331} PAGE IHIi SHEET p;m(5]qq1‘:[;]3;t.£a1:3'n7d;|rlfl1?;sIaJGiOIt‘ il_§h¢fil|‘:.Dna:nrmumuf131¢fiJ1Ii:‘a'mg' saammn.w~:a=m"-mascma ' mL1‘IaiJ1I:EIisdI:'II:Iis3dl. ‘:5 mfimummacgwfimwmmméwmhfimmwwfimmseaeahkmmiflifiilhfifir Ideas: myon. * ' %§m:n'o&'£52 - ' ' ' CI {h}efIJ _ , El (b}I1'?){-all El Edit?) ' 1:1 453:1:-_ I: mcn-in)‘ _ '_ 4: mm E'l{h){3} I .- I-}E{|'=J£?}(fl3 BN5}- = _ U wmlwn E1 0:342} _ in EhH?'}(F.| U omis- __ I] {bJ('i']-(F) El (2341 I3 (BIA: :1 Ms} E: mm ":1 ems: :1 as)-u:=-:u I3 110:6: I:I nan-:61 ' U inc:-m 1:! In_£:r:n:a35uupa1:3nedquJywa1h3rd_pan3rwid1nu:ncEatImc.-H to fl:e:a.LE:jact:>f3-uu.r1-c:qL9c:s: mj-1J:u:sI.1hj'1:-:1.-:ufj,r::uur tuqtxstkfinodinflactéfleanly. -- El Du-=uJ:-mi: miginaladwimmathcrfievuumcuxagmq-(m1. T.bficdDI“.1J.131I:nEs wcrcrcfcr;-ac[toLtn_aa,g:eacg:1fncs] forrrni-cwsnd «find response tn yacru. Pa,-an contain EIJ.fci ]"agn:[s} I "X Nu 'Dup!i<_:1LicIr2 Fu: )4: Fur this "pay: X ITTTEXXXFXVJKXXJLX I=:‘;I-'I2IF.Ii ============================================= ./texts/FBIZodiac5/116.txt ======= G?.|.=,£E ?RE'~:_-'Ef{TiG?& EIEi:.0.'zfiS TO E‘-_IEr4 *rCH‘;‘£ ‘w"""' __ {_*L£u1‘¢7 /-\.'5/r-=:.:uz‘I=~1 J5 5'!” .C‘:\1v—.fJ3'lr c.-I/r'-r-*—_u /’ ;_TJ,.-;1,_r,{ fL;J§tu/‘fig; ,.r,'_,.,.,_ )§'|qa'.’{,-F/‘:3?’ . ,/E;-3}”:-., .r”'21J;. .533 3.5 3- fr’? ============================================= ./texts/FBIZodiac5/117.txt ======= 1;. Hzmma 5.9 5223 Hmnmnnmm HE arm monfimn nmmm. 2.. Emu :3 mam: 333.35. mmawcpfiumm .ES..“. RE ow 35.3 5.253 amam $323: 5.“ Hfim moflfi. _ 1'.-r-MI ============================================= ./texts/FBIZodiac5/118.txt ======= :2-|>4:.a.2o :12-5-9:21 ' XDDDQK FEDERAL BUR.EutU UF lN‘iu"ESTIGATICfN FDIHE DELIETEII PAGE HDN EBEEI Fagscs} wirlmclxl e:n1.iml3- at H113. lo-canon: in :11: filc. D-I1: on-more of we follerpx-ingslate:n.eu-m., ‘A-]:Ic:'-3 indicxod, a':.pEa."I.U. 116$ 'd.GLCti.W'l. D Dc]-=|:'LoJJ:5 were mods p1L[3I.1am tn the etxmptlmza imilcaxurl bcluw with no 5&3!’-Egible m.aI.e;n'_a.E available f-Dr n:|.|:a$= no you. Ml]-11553 552:1 5‘ |fbI|'IJ-]' '3 l}3'3'5'T"Ia"-SJ U |I:1}{E El (EDIE? El {I:I]|['?)(B} El {jjfl} U {'='?'I3l '3 (§|}||.‘7l'(C’§' U CkJl'1} _ El {b){'UlCUZJ 5‘ KKK?) __ D fl7III.”?}{E} El -[kJ|(3I' _ El |31}I.‘fiCFJ El flCI[-1} U #1:}-#4} El {tillil-2»? U fl<}{5J E‘ {bI|<5}| U 0=}|.'9J El GUE6-J El -{l?J(5} U E31}-ET.I El I:ufuLmmn:Iu pexmjnnd only to a ti-u'_1d party -A-irju no mfiz.-con: tn flu.-, aubjcn of fun: request or the aubjafi of you: t'*2I;§I.u:.st is list-ad in the title only. El - DcIc1L1;'1.tn.15 oJ.'i_gE|:uax£d with anothw Germ-mouant fig€Er€j:'I:_iI’:s]I. Tim-.5-:: dncummxs -were refs:-reg: to 1113-! agmcyfiosl for Ilwlem-' anti direct response to you. Pay;-.5 oootaio ioformaxloo Eumialmcl by aocrtllcr Gav-sn;IJ;I'Lan1 agentflirfi}. You wiiitle advised, by the F31 as no Ibo roloasobfliw of this information following our C-cuusuljativa-:L w'_i,€|:| [bu may agen-::_-.r[ifi]_ Paazfisfi V-"lt~"J}J.E=1El J'=1='31flJ-IFJI 35 8 fitilai mluase datanninaxiun has not fun: made. You wj_l]:|e ad'p'i$Bé as to me ~\'a.‘L&j[K='SiE§cvn at 3. Later datc, 1‘ Pages wart not considered for ralsase as Ihty an duplioaatfme ref‘ .‘rt1£Ep'$ éLA_|,Ia.-.151»-.1. 52:". HS _ FJEECEP '''-'''l‘3W-E'-d- 50! I11-3 following rnasanfis}: W TIIIE |'I2I|.lC|Wi113 ITlzI?I.tu:I' is_|:o he used fior ra~t'ersn-ca n:g>a.ncli11.g E9292 uagos: ?-=r*?*H.-'- ri:'_fi_oItF mu. 3!. .-,gg;s_L1l fin; gs-a IIKJOEXXEEIDLXXXKIK K Dclzlud Fag:-{3} I K N0 DL1[:I|.i.c3.11'cII:| Fez I K. for ‘U-.|i,s page X KKJSXXKXXFGCEKKXXK XX)-EXFLX XXKXKK PQXKKKX ' I-fir:5:Im ============================================= ./texts/FBIZodiac5/119.txt ======= mum ,-.715 ' ‘"5 ' % FEDERAL RUREAU OF JIf'E'ESI'.(GA’IIO4.'\T HJIZPA DEIETIED PAIR HWORMAIIUN SEIEET 92- Pa§c{g.]wi-fl:hu:1,d_¢ufirclj‘a115=.5alDC3.|5GI:I7nfi:fiI-b. Chnwmmzufmefiaflofiingstznunnns. hhflE :,1;II£a!fi11's£Idfi.|fln. F nagumgqagmaagpumzmmdmmufifimshfimmhdmwimmacgrcgzbkmuahliwfifihkfir nd.casr:wJ»‘0“— ‘ now: _ . crthxrm ' Dtwl‘ ::im:2J_ cra:mJa;B:' CI 01:2) urb}£3J I ~ I -}§tb3t7)r.'C,'r I3 fl=}€iJ- pxanxncm ca mm __ tram-my E1 ma: =:Icb3r='J-:I=: :3 {EH43 a cum} Elf-|:}[3} Urkrrm "swam ummu 13 (£1-:6} D and: Uh:-m III Infcmalafiun ' 'bnJj(1r>aflrb:flp n-ifltmrcfcrunca:zomcmbjamufwurrcqu-mexmnmbjutufyuw pcrtamm a.rr_-.r 1.'\:»q:Ix:st5=LE';Ir$€lEx:.L1l.¢fli&CtIU.i}'. '- EI Duazauausodgimamda-ifl1anoth:r(§arcrumnnagn3:jfj:a)_ Tncscdommmmwuemfenedmmatagcacyficsj 50¢!-.1-iyswaaddhnctraspansc tuyuu. Page‘.-'. contain iuiamgajun fiasnixhed hyamdaar l ag+::I.|'_1.-'(Ee.sJ-. ‘You 'hVflJ,hI: :|I‘r'i::c:i T:|_'p"(I3= FBI :5 to the ralr.-Is-ab.ih'-Lgr arfuhis 1'a]Ju-nringou1Ienu5I.IJ.uniun wi121thc uaincr ageuayfmj. . P=aecsJwembcLamasmmeJuase:zaazracaseamm;mLaannasuu:ba=nm.aL Yuuwfllbcadvimdastaflac di3pas'LIiuns:a!a1urda:.:_ Pagcswcru u-utcoesidcmci for sdeaaae as Itwyare iiuplimzive uf Fag-_-fa] niihhdnl (ti: U3: ti-_t]]qwi_n_g rcasoxafilc .31 T31‘! fi?'|1U°r'iJJg Du-|I.It-ct is to ‘used for Ieftmunoe-rcgazdiag US.-L-c pagr-5: *E-&1$;.{- .51 EH53 gang. 4; 1 £33.; 531 :5: _J I X Qcltbud T-‘agcfisfil X X Wu Duplication Foe X X For this bag: I KFKKXKLYECXKKXKX I.‘-'k' Xm XXX XXX :’*-3753-3;-"'3 I I=I:I.II::n! ============================================= ./texts/FBIZodiac5/120.txt ======= o1=::A<::t:- {l1n3~9fiJ E XJUULKK XXPGCKX FEDERAL BUREJIU D]? INVESTIGATION FDIFx!n I-‘E-LI‘.'-'I'EII l"1iG'E EJFDRIIIATITON SHEET Pug-sfs} wlflrl-std eutimlzr ai this lo-anion in the fiJ::. Gene :1: mo: of this Eunowi:-.gs1;atcmeJ1rs, 1.ir1L-are tum-;axg.a, expL3.iu this dcifiiun. El Dctctiom wens made puxsuauu 10 um cxeuuptiomu, iunslcanpd below with no sqgcgajala an-aj1a_:.]c for release ID you. S-mien 55;; gag‘ El 552:; U fl:IJ(1} I3 GI.‘.'|.‘7jI(2’t§| El MHSJ 13 {W2} I:| {b}C'-"}['B} U {E'|.T} El E|:I}[3-II El ('b}IU-‘}[C,‘I U (K1-[E] __ Cl (3J}'l'?J'{D} '3 mm _ U l"='I|'("'-WE} El fkJ(3} __ D WJUHH 13 06(4) El EEIE-=13 U MES] El fi=}{TJ' El fa}-[5J' El {W93 5‘ {kI"I*5} El {bJ{‘a‘,I El 'lJ€}If'7J El Enfr:In:ua.ti-mu pcwtajueacl only to a third. party w'ui-nu: r-sfarezllne to aim suhjozt of ywxmquust ur the $I_|t|jE.1.'1 of you: mqusst is listed in the title may. El - Ds)-cunasuts ufigimxnd -a'i.LhanoL1u_°r Gvvmuztaatl agea1¢y[Ecsj|_ ‘Thu: du:-r:umv;uLs were sejécmui an my: a_ge:|1.::y[ies] for Ieficw and dinefl {esp-cuss to you. P153 Cfifltfiin informaiion funvishad b3.r2m1.bcr Garvermntn: agutcyfrasj. You urillbe ad:-Lem ivgrthe FBI as $0 111% I-2[Efi$E1:'iJ:'I|I’;' cIt'U1is i.BfcIm1.=.1:iI;u:| f«:I!Eo‘wi_11guur |:pD.|;|31.|JE:ll;i:]:] -nu-ELI-g Lb: c|U‘_‘u:r agg.-,|1cyI{i,as)_ Pa.'_:=[sJ niéhhsld inasmuch as a final ielcase denermjnaxlun has not ban made. You witlbc :u:1vis2<£ as no me fiii-pltlsitinn at 2 late: dam. 4” Pagfla mm not cnnsidzrnd for terms: 9:. stuns; ax-2 d.ug,~];i::tiw: uf .2 c ..-u‘¢ ..n’pn‘_<. Pagers] wlfllhcld fur the following :-usu:-a.(a}: l$ TIM fell-:rw'jJI_-grrumber is_|:o be ‘u$:d forref-srermc regarding, U1-35: paglzsz -=;- Wm. ;i.r_a‘L,r1-.I, Mg, 9+. I range. :31 Ha ffi KKXKJEHKKKKIKKKXX X Dticttxl Pagdsl I X N0 Duplication Fm: X x For unis pagc X XIXXXXKEKIKKKECX KXXKII XKKXKX XXKXXK ' i'|$l§'l,'Ii_.'I_l ============================================= ./texts/FBIZodiac5/121.txt ======= UPC.‘-.-35 U.'3«!—PIC-II " XX.2C'§_F(.X L BLERIEAU OF INTESITGATTOIV FC'lL’$ DELETED PAGE fiWW SEE-FT E Pnguis) withhold nautlttlzr at Ibis lutatiun iI1:.’.1e 1119. D11: or more oftlvc faJJowi:1,gatammam$, wl-.-are indicamd, 1&fi_p]aJ'.11 this dcJct'u:nI;u_ H Damian; ML-n: made pursuant to 1311: c::t:a1:|ptiu:|,s j,u;|diu;3,Lpd baluw wim |]_q gegrzgabjc avwlablg fa: Iciaase to you. on 5 _ Ci‘ [W13 El {WT}-5'2‘-3' U {dJC5J U [him 5' (WWJCBJ U '§jI'f1’J' El tbji"-'iI' El ftl}-{TJECJ E‘ (EH5) ,._ H '|.'b)|I73-1'0] El fl‘=J{3C| _ C‘ ICHIITJEEJ '3 U09} __ E‘ |.1JJI1'-"Jl'-B U |I5€}I?i] '3 HJIIIC4} U {W23} U MICE! U f\3'}{5J El |3r}{9I' '3 CkIIE6II £3! -{"«'I'|I'5'3' El CE.‘-'f7J' |:I Info;-tuxtlcn pecrtaimd ml: no u t'|:Ii.nd pa.rr_-.r win: an rcfarmca no It!!! $iJ.El_]B=!.“I 43Ifj"¢'|Il'1’$quc.5t Ur the subject of }.roq.|_1' rvsqumt is lie-tad. in L112 11112 0:13;». El - D¢'-‘-ILEI1-W15 Uftgi-1"3I=*‘i '-'-"M! 30'-What G-Wcmmcnt ageacrljs}. These flD€=|JlDE|E|[S were refemd tr: U331 agcuc;-'(iu) for mvicw and direct I135,-calsc to yam. Pag«% contain infnnnafiua furnished by auotbm Gu-«mum: ag:-.u1cy[iw]. You -.-51! tn: a,d-..'i,s5d byfluz 1’-‘Elan to the r-31-5aaabi|1'.i}' of1:ELi.s Ltlfwrrnaxiuu E:-Ltcrwingw; ;.unsuI'|a1j|:|r| wjm me an-uer a_gx:r,c3('u;,-.5}. Pag9[sj ~,w'1J:Ji1elc:<><:»: s=ar.=;por ============================================= ./texts/FBIZodiac5/123.txt ======= -:1:-ca-10 [:2-a-3m % 3' I133?-LXX FEDE-ll!‘-'\L BUREAU OF’ ]NV.E‘S1']'GA'I'ICIN F0[E'.e'L I-‘EI.rI.'I'EIJ PAGE DTFCFRMRHON SHEET J IP:I.g-3(3) urilhhcld anfirsly at this i|:II.'.a:.iDI3 ixtthaz film. One ctr more of liha fc«11¢-wing sta1m:rI.s:n15, where ij[I;fir_3jufl7 :21.-;I|.a5.|:I M -d2Je1.-i,-an. M Dei.er:inms were made pmsuaxat to U33 man-npnicm indicated 33-elcrw win: no szgxegablc mamti.-21 a.vaciJaht1z Eur Ialaasfi it} ]'0l.L. in-g 552 Ejgaaigzi E: 0:303 :3 {WHAJ =3 -id]-{5} El mm} D (ti)-i"-"Jfl3} E‘ |IJ')t‘3J I3 cum: El fbllfii-[Ell :3 {Edna ._ DI Etumcniu El 00:2} _ El -[b}f3‘}{E} J3 rt]-£3) __ E: I31]-f’r'JIIFJ E1 (Inn:-I3 El may D rtucsn U mam U [tom U &r}t9:s I:I mace} El {hm D tsc?-NJ El I1.‘-1fDI‘fl1:3tioJ3 perrtaiutd. uuijr In a datrd parry wimno Iaferwoe be um .':LLb_icA‘.l mt’ yourraqu-$.91 or the subjcu of your J13\g_:|.fi|: is listed in L'EI.<: title om}. El — DI:n:u.1-n.eu11x m‘igiJJ3‘l%d wirlnsu-mi:I.u::r <'.'rIr.wI:|'|:I.|:rI.tn1I'. agerJu':_-r[':=sj. ‘mm do-:wuc:1:s wrm: Icfanacl to max agency-[ins] {or nrvicw 3..-I.d. di.|.'EI'_‘[ r;-apazumat 110 you. Pages contain Eufcrrmaticrn fummlmi by a&<:=.h¢:‘ Gm-mumau: 3_gw.|.‘-}a'{iC>S). You w'.iJI|T}E aavisad by thc FE! as tn the 1.'EJI:asaJ:I:i[il}r I:IfI11.i3 J'.'rl+'0.rI:I2ati.r.'>-:I1 fallvwingour Ufi‘]1fiE|]l3I50Jj vrj,rJ1. rJ1.-5 ¢g,Eu;u_- a,ggnu3r{m), Pagyats} wlthlieid Lnasm-.n:}t as a final mlcasr: dam-m'uiu.afiun has not been made. You witlbe aaclvis-ad as to nu: diwositicre at a law; data. Pam were not mmidccrad foe :rdI-:35; as may are dlnplicaxiw of Pig-Bis} ‘-%'EI'.b.bc.Ed Eu: ihv: EuL|<>wJ'I.'I3 N=\5cu:I[s]: £31 The jbllowing uumiaer is to bl: used for zcfurnnce regazdhgg H1332 pagrs; ¢-‘F‘?_1U-I"-F .1’ PI?! ,_fi_'J‘ .T{XXZ':X.XKX:’iXX.X3'C?f_XK K Dclelinti Pagu{s] K X No DupJ.i.ca.:E|:In F22 I X if)!’ T.'h'l£- [2I3,gI'.' X IKKXXXXHECKXKIKK XKKKXX X}t"XX3x_J( XXXKKX E=fiIn'DGJ ============================================= ./texts/FBIZodiac5/124.txt ======= '3|’C»§--Bill {12;d.965 El _.L B! - Dacunxants originaxeacl with another Gcwcminet _ KJGESUGE :-U-U-€.3{}CJE "1-"E".DER-AL BUREAU OF |1'V|1-"ES'£'IG&TIDN FCIIIFA DELETED PAGE mmmmnm SEEIIET Pagecsjl nrimheild Elliircly : this in:-ca.Iicu3 inthe file. One or me 01' me following siahementa. ‘Rhea’: infl§<:a,1:_-,d,, upiajll UEl.’.~. demon. Deletions were made pursu.-mt to the mtlupticuus laelow winh no segregabm n:IaJ!e:|'i._aI avajjablc for release an 3'0-|,,L. mmafi L Cl U='J'{1II U 'fbI'f3"}{fiJ U {fl,'|(5I' El I.'%r)I.‘2'} E? fb}[‘?Jfl’-‘J E1‘ '{1'}[3J El {DJC3-J El 'l'|='I"5'}|l'CJ| El (II)-{ll U lib}-|.‘7){DJ El flclfl-*3} El I.1:-){T}f5i' U I3’;-¢.'3J U I1'b)l°7"3{FJ' U {EH4}! U fb}-[4] El [tI]-{B3 '3 WES} U (OM53 1:‘ {bI'(9_‘1’ U fkJ{5J El [|:IIr['5J '3 '1'k)t’J'} tnfarmaxinn F!=I.1ai.11Dd only to 3 zaird party with no tefmncc In the subject of your nzqum or 1112 Sllbjuct of you: requcst is ]1'st<.d in the title onJ;.r. I31 agcuczties}. Ttlese I:I.ocI.1|:n:enL'a ‘were referred Lu Lha; agencyfica] fiat: rmrlcw and dim: response to you. P:-gca oontaiu ir|.fi?l'.|12|BIE{}]'L fL2m.i:aI1«e-:1 by am:-tbsr Gav-a~r:n.mmz a,genc5-'Ei&s). Ymt will bu: adviser! bytbc FBI as 11¢-Eh: rclcasat:-'L|ir-y ofthis Lnfnunation following nu: cnngulzniun w_i_|]1ll1e mum a§an,c3-(j:;g}_ Pageaisj w'.i1l'Il'u3l.cl inasmuch as a fl:1.a.1 It:C|c=aas d.r2trn:u'.I:IaIiI:a3 has IZIIZIE hr:-an name. y-‘Ga w;_1_1b¢; ad-5-E,:.ad as no um dispusitiun at a, law n:1a.r_n_ Pmgts wan: 1106. c:IJ:I.$i.d.E!I'EI2| Ell‘ M633-c a.s1i:Iag.I arr: dup]ica1.‘iw: of fctfii-_-I a 153.3»: 325317.: P9315) w'ittI;"I.I':]:1 fort Eh: in-lloI5'U1,g t‘Ea$cI:I1I{2.}: The fullm=J';ug number is no En: u,s:::d. for rw:Ren:r.-n.cg _ [Banding tame mg-:5: - I1‘-3-g°;1g;,:w 'BnJ.t'.,{_¢g. Ah‘. .1’ J-r;.L_aI3'|-I #5 -459 }€I=CJ(3{3E?C3€r is M: b-§.= ‘used fiat Ificxcucs-Ngarding I'.'t:c.ac psgcs: 4" ‘.f¢FfiI_'— ugiu sup: gf 1 $1 -J6-0 "flit 3170 L X TJc!c-ind Fag-:[s] X X No 'DL1|:I5i.u:.aLic>A F:: X X for this bag: X :1 ND: XI_1C.XIIX."(_X'}I'_XK7‘x'.>UU5 Ii; l'\'_5I ..'€.‘- I ============================================= ./texts/FBIZodiac5/126.txt ======= Iwfiepe-_l . . . .mm.n,n_n.m 53. ._3 many“? 3%: mmmupmm mnwfi. we Hum pmfi. uEmSn.£._$ .,:_mflfi.En_ £3 EH 9% 3 $5 uwflam 33. En ufiamumy m.E.._.._:3, ema awmna ============================================= ./texts/FBIZodiac5/127.txt ======= mm ,1 % -- xi’ L ~ ' £fl3ER&BmE&UflF flmI . FUIPA DELETED} PAGE INFORHEITION SHEET pggag}y&mnufim:hdyu1hi=ID€:.fiminm¢fiLUmmmmtafflmfiEw'i3g#3¢Efifl5.' ngulzinfiisfiduifiu. |:| mgamwmmmpmmmummmemmmmpawwanmswanwicmuialivfifihkw !fln=a9G1D}'*3“- ‘ _ - '65 _ . _ -mm _ I: (i:}[£j _ _ fl nib}fJ'J{A} El I-1)'55i' ' I: ::r=1n:22a_ H mm)‘ _ '_ H mm El-Eh-}I:3-J I .' u-urhmtcn Elm-:I'L _ cu -:aJaxD1 Er mm n':: {hxncaa :3 (mi) :4 {Emxa 13 mm D n=:»<4:+ I: mus: CI (km ' an {HIE} I: (am I: cm»; :3 4|:-:u(-:1_ ' 1:! mm El Iufotmaaéma pcrtaincd crulymalihirdparljrwixlnmmfcrtncc II1:I'|3J.¢.5IJ1:I_ic|\:I1:lfj'|:I|J3'[Iu'.II1.fl oinacsvahjauafyunr _rI:@1:=:ti;i.Es'.A:>c1i:I1';|:In:::i::.-_-cm13,r_ - CE Dooxzmmscuig,-ina5ndad:hauaa:c:Gwcrum:;1xagacu:1n.'}:s}~ Thmcdnmmmns wcfcttfeerud ualhaqguczutyfi-25,‘) I'ur:J..-1-‘in-we-mi dficfl. map-case to:-'cII.1. Pages -:-muaiu i.|1fol'maJ:3un. fu.rn.i.'Jmd trya.u.I:rd1.¢r Gm-umm: a.gm4:yI[J'.|5]|. "nu wfljbeady-iaod hjrtba am 35 in itlc ;:1-:as>a1:i!i.j' aftbjs fa-]Jnwingau.r euusu11:afi.c>a1 wi¢11,hr.' mher ag<:::u.:_-,1_’n5}. Pa,f:e:{sJ w-}tIui1sainiiza:as.|uJJcI1=i3a.I’.I'.:I-.'.\1I\eJ&EIS=a n |1a:%al.0-tb4n<:1u:|3.I:1c_ Ycu_1v.IiJ,lb¢adv-iagaiaslloflm. o'isp~:I:Eti.uu 31 2 [aI.r.1' d.a.t.2. £35 Fag.-_-. mm: musidemé rurmzr.-ax as mg-maqusmwa 3-y«_;9.r.«. gar _:g[[g;.T, M, Egg flu: 3.2.! Am 4:5: T Pgcvisj .=«'jUI3n:Ed For U1: J;'qE[.au.-lug n:a5-mp[.5}.- E 1-M ='°“'U“-'10:: |1Um1>~*3" 5= W '21-}: izsmfl for tcfcrmoc 'fG U153: pagcs: - :f- L nr. £1 L X Dcicloci Pagcfls] K x :’\.'u EJLJ.;r>!ic::ua:2J __ f:I4:h)('-‘J-(E) I3 end: _ ncuamcn 1:1 (km:-an U [En]-(4) El {If]{3} 1:|'G:,'2I(5:l '::r:b;»<5} I:Hh:»c=J U ckx-5:: CI :a1{6J_ ' C: film E3 Iuia:maflonpcr:ah:cdhn.E3'wami:dyart}'wi.d:uo;=£wmcztoflmsuhjod o\f}|'flIJ1'11:\I'.]l;ufl1 otahasubjuctvfyuur mgIu:=Lis|1'Ut¢dinII:.cIi11¢au3_~p', -- El Dm|flflfl30fifim.1.cfiWxhmo¢HG0wIflflagm?fim}.Thutmmmmmwacmfinflwfi:a;hmfiIfi] Farnréewsnddixuctrsgouescloyuxa _M_ 3’=!¢;1:sc:=d1lsIiu.i.n£cI:1i1aJ:i.c>u1 mmiszm l:ry:.11._ofl1ctGrm'mun::I.t .agcnI:__vfi:“—'u]_ -‘You wiflbcadvisedhyflae FBI as to the rrlcasabilitgr -\:uf1.11.1:. E E'cI|1.nrnriu,g;cur_c::n5uJ1::tiauc: wish the Ililfl;-1".*[ a.-gnzyfifij. Pazeisj mwmddimsmwuuafihamum u aasmbmmadc. Yuuwszxbcacmsaaaumgn-2 diSP<-‘liitluu al a iautcr d.a.I!<:. L P356 won: 1:-<1 musidmtxi E<>r1:r:|.-5-3.5:: as flbcyam iiuplicgafive of 9', fiF?‘?f.f.. {fir ,r.j'_;_.J,t'.,. 1 ,af. 1 H" 1;: H.-"._. 3'?“ 5P9-Sfiifi} '*'iUL|1r:1d fur the fio1Iqw§.ugre.a:.an(sJ; Kg ?h=8 t'0ll<>.wiI:I_g number 5.-. to be; in-31$ far r-arm-mm-xcga..-xiing ua-_;c psgcs: _ rwwa-an- um 3/=-“hf g;¢_,_,,+, _4.,;.,,_; 45': +5.-._wg; .KK}U{ K I3-L".-::|.<:=ci Pagcsisj K K :“€u fluplicmjun Fee )4. K Fur hi: ‘p.-.{_c ‘AC _3{}C.‘€I‘C.'J\- }CK1iXX/":KXK}\'-'.5\'-' .7'CI‘I.>(}€}'..3{ 351 EN} .1 F-'}'£K}I_'< f‘: ' ;.-;g;_..-,n_: ============================================= ./texts/FBIZodiac5/129.txt ======= |'JJ'ifi|"-JEI:-'I'. E-IE2:-TEI. _ ....,- 5. I . . F B] E , 3 _—_J '-k-- “ THANSJIET VIA: PHEEEDENCE: CLASSIFICATION: : |j TB]-E't.!r'P9 |:I Immediate |:| TUP 533-R57 .' |:| Facsimile r_*1 Pzieie ‘T. :1 SECRET I 3; Airtel [3 Routine [j CDNFEENTLAL : ' |:| LINCLA3 E F '1' 11- : |:| uNI:Lm5 I Date ' 1 : TU: DIRECTOR, FBI £9--£5911} ATTN: FBI’. Lncdtetccar , DDCUIENT SECTION ERGM: 53:, SAN FRANCISCO (mt-229-5} [s;;.1{J} {'0 Z3 .3 D 5.53 5"-}'::j£_ SUBJECT: ka. ?ictim Possible Extortion 9%}: San Francisco Re sen Francisco airtel to Bureau, sfzaysi; Bureau Leh examination Report to San Francisco, Efzfifal. ] Enclcacd for the Bureau are four lctte 5 with “analysis of an article frerm the pen 0 a so enclosed. Each letter, addressed -t Supervisor, San Francisco Division with [A dated as follows: 1 — letter with ane gels are ens. "_p'sis of article, dated ‘'1 - ie tea: with .5. yeie 0 ca e dar regarding Eu Lac murders, dated fifzé . - letter with analyeie related to Zodiac's telephone number, i.e. telep ne number of dated 6 Eflffil. 1 — letter with analysis entitled dated In con cti n with previously submitted documents, as an enclosure with referenced authored by captioned individual, detailed analysis to euppcrt ecriee. i.e. communicatlun enclosed herein is hie previously expcee 0 .n. :55w Bureau [Enc. é} 2 - Boston {QB-3930] {Info} 3 - San Francisco RLS:kcs _L6} @380“ “gm Approved-. TI!.|3!J'I'-ifl'.4§|i lmmbw} aim: Per 57.5 ============================================= ./texts/FBIZodiac5/130.txt ======= vl“ ,5- SE fiflrfifififi 1‘-I15 : knee - :‘ This analysis was re-gueetefi by Supervise Q anfi interviewin ents an fif22;'El whe is inter- viewe regardin curnelairtt of he merit in the Beaten Difice. rum reee p -. I anci ~;ra.'r:'.eue articles; eent re him by 1:15. e . . mails, C iee of these euuleeuree are being furnished to Inape-:tr.=I San Francisco Police Depertzment [SF‘P|3} , who is as erg e D the zodiac killings investigation within their department. Ins <:t|::- was previously furnished materials received by 5 sent tn him I55- Sen Francisco is unable to E15-SiEI11.'lJ‘.at.e the validity of the enclosed aocumente, along with the previously suhunittecl materials, purported to be 3 '.e|:Iluti:;In_" to the identity co_-E the 2:-_=;:!:‘_ac killer as theorized la Due to the conrplexity ef the cedee r::f na e .5, his material is being forwarded to the EB a _ cry Document Section for review, :1-_ is suggeete-:3 that referenced airtel and Lab report {refiergngga Eh{!I"i’e] 1- be reviewed prim: to e:-ca,-nj_na-t_1‘_m-_. of the en:-leaned, metgrialg. The Bureau is t{: note that on ?fEfBl, 5 generally advised that the FBI Laboratory was not convince that he had reacheil a "ee1uti-an" of the Zodiac codes in hie analyefig. It is Eurthe noted that in the e-ncieee-<3 eeamunieetien, entitle-il. F ae;echee an adclit -anal the E in which :2 a.e e la. e 5 -31.1 eerie a copy of it to as again werne-E that he could incur bath cr euhtinuing to send materials 1: in fact sent one mere :31-:1 t totally "up front" with the FE material t.I:.I Exes also advieeél that the enclosed, ma:-_er:i_e1e r_-on-— cerning E at codes would be furnished to the FBI Laberatorgr for enaly-sis and that he would he advised as to the findings of the Lehuxetclry, ia iliti-25 by eteted that he had He stated he wanted to be an he 1-mule never again send any 5'?’ Y ============================================= ./texts/FBIZodiac5/131.txt ======= W-’ M S? 9A-223$ Hbfizkes REQQEST UP THE BURERU The FBI Laboratory is requested to examine the Enclnsefl dncunx-ants an-5 those previausiy pr-mu-idea tu detgmina if there is any validity t»::+— claimed "5-:-3.ut;ion" of Endiac killer-=5 cnaes. IEADS BOSTON DIVIS ION _ AT BOSTON; NASSBCPIUSETTES. ShCI'L:1. receive the car sent to m recent 3 camp-lains to your office, advise tha.-t. as been ac‘|mcmished_ and‘ ‘assured the San Francisco EJ£v:Lsa.un he wuuld ceasa and dearat any further communiquas t |Ln.| ============================================= ./texts/FBIZodiac5/132.txt ======= 4 5 ' '_-J 3 ' } JGCKXFK FEIJEBLAL BIBEJIU UP INVESTIGATION . FOIFA DE.£'I‘El} PAGE IDIF'C|Rfl:[e|I£|}N SHEET (I'll).-fl (I2-3-95 Pagda]nihhd£mfirflyuflfislnclim§nfi:flt.Omqrnm':nffiIefifluwing:t3Aanmu. '- 1: mgaummnmmpumaaumuuumauihmmdimpuhawwahmswmhkmwiflfivialifificfir ufieasctayou. _ ~ . - __.m _ . - . nssaa :3 ($1111 _ . I: (tom-can U was)‘ I'_'i-Ifh]IE1'_ Eamon‘ _ '_ cl mm 1::-:::;»{:=-in ' .' --|3|{b)£i'J-33:} u~:r=;-rim E1 cwaxn) :3 0:34:25 €:In:_m:ncEn U taxi} cu {hm-IE Ea a::<=u U can-1: U-3::-car: amass} ‘Beam 4:: mm :2 cm: :1 -.wsa_ ' :2 mm I3 IflfilrmafienQcrtahnadi:Inij'LcI.a1!Ji.|'dp3.rq:'1'!'i.d:1:IcIIe1'cmIx:=tI¢I!:»c5I.B?;']:-Ct12f)'fiurr’acpI¢$£orlJ1.c£|JIJju'IIJf)'mE r\e:q1.se.-.u;isT.|'sr:;din:I:::LErIcnui;-. - El Ducnmcnrls uriginazndwimamaficr Ga:-ca-ummx 3,-gcucyfics}. Thcgedocnmmm wc.-cxtfc-xnd mihuagmq-11:5} Fcu'rc's‘5tv~'—a1:u§'diIcIC1rc@ons.:to3.ran1. j Page: auuxain i.1J.fcuma.t'mn Eu:-.u5she-fl I3-_va:1g:rI:hcr Gamnmm: a;cncyv[Efi],"‘&'cu wijlbeadvigzd by-nae FBI as In 131: ::r.‘.1va=as-'a.hEJ.i:y of IE1; t'oU.Dw'p1.gaui_uou:-milatiun viii: the ad:-cr ag:;uJ:_-{fits}. 17'3.F[i}fiiibb=ldiua51uud13safim1mkaa:dflfl:n.Eua1mnhasno[bammaé: 'fm:wij,[IJca.fivi5ad,a.sm-lbc dinpwificmasabmrdsxe. ' _1’__ Pages were ucu: <2-I:-r.SJ'.I:|:3r-...:1 fur ncleasc :1; am; an. iiuplicaxi-rs: or ?v 5-£3‘? .-'.a"- .z.13"' Fa-56(3) winhh-cLd For um faiiawiag n:a.3aw.{s}—' '9 Th: i'U"cIWing Dunbar is to tn: inud for rv.-.EcI:cn:ac.rqanei:a_g El:-:5: pages: 9'flf'!‘f- H:-J (Ir. F1‘-2. _’g:§.-_ ,_.§'I'l'r K O-:!c[oci Psgcfs} X 9C Na Duplicaua-L Em; 3C 3%’ Fur Ilzis i.‘--":_s§I:‘ I XXKXEJNIYHXXXKXXX POI KXKDI i-'5:i:'I:-Di ============================================= ./texts/FBIZodiac5/133.txt ======= dzwma-an cu-3-am . 3 EDRFJ.Ufl£mW".fi'I'IGAflDNI DH£IEDPAlE EEEI' 45” ,h#,.,3.,g1- ;,.g.a.m..=:y- aa:1i:isio¢au¢u1' amefi1¢om«mmu£mem1buengamu¢m.m==='-m.5=,m- EEIPA J :_J #1639-t II? 1'03- smnic--:-’ 551 ES rIl=}CiJ' r3 :aH1:«_ EE {EH3} I3 {b)(4] ' tn nu-:3: U a:)«:J€?‘.I(hJ‘ - 5:: u-mm In aamzm III cbncmlsj u comm :3 9:1-:3: I: chars} El Infunmzniunpu-.rei.mi buiymamixdpmnrwhhmmlueune |!UfiLa£t1'|:j-:1!-of J.'|'3_Tx.|1Cl'..-1 i31i:—|.eA:[ Ends: LSII-u:un_13.r_ ’s.=cuou@" _::I mm‘ I3 6142} E] u.;;..nj . 13 ma) :1 33:5) El (234) G M6: U 00(5) El fcw} 1-'4:ru:n:=quc:u cu"-13:: subject of].-our El Ihntuaculs U tn-iu:u.auuLh«:r Gm-cmmnlt :-gcnqlfifijl. Thus: mic:-c.um:rJ,u n-qacmfq-mi 1_' 15511:. . at-_ M E3,m(;E\; , L,» a «J K x33 .1'I.')‘ «H 7" "L-‘i EX-:[|B.§RI‘.Et1!'.A]'E camplete-d 2 Dlctclefl g J Time Daze ' F‘ Dali-3 ' ~ 1} =g.¢r: ============================================= ./texts/FBIZodiac5/137.txt ======= -2"--a-:2:-~‘ i'1:EJ:e 6 ============================================= ./texts/FBIZodiac5/138.txt ======= qL1-e'sf.g» 'P'a1_lBj;g nl-£4‘ _ _ ,_que.m._d._ =:aaa?'§‘§a ia"b1}_iT"Hjr"i: * ' 'F'.'b ‘D-n. -1'::"*-!.=_*E. AH ‘.E;~m:i_':':1m-..:~‘_; 1=nai'::'u_:1sc_u:s fficéiéiil _ 'f=-'fi3n'I:_fta,{nj.ng a_ :;ipy'-“of t "‘ 1,5.-'='_a'_:s1e'.w:r a.pé-=I_..='r=,=.--, :35’? _:=n1;_'_1.ab'a§at'm'.~y 'a'riéI :dentt£;m=aoi:;‘%.£fi% ============================================= ./texts/FBIZodiac5/139.txt ======= _ . 1B1v?ers1d_e;.'- C-§1_ifc-1-ggia 1:‘;-«;: F311-.qabhxn.p¢_ . 9::-.__ ./ 3.7": -"1?" Any’ -fiéifis - 'v-.-.n'- _ .--..- . ============================================= ./texts/FBIZodiac5/140.txt ======= 'II_i£”u_'n_r1c_iII}oi:-' gt <>.-.n:':-. NGEnfihEH%*§“ _#AfEfiT H ============================================= ./texts/FBIZodiac5/141.txt ======= ============================================= ./texts/FBIZodiac5/142.txt ======= Sj:-eci&:i'1'g§e'ni in ;:h'c-nie ============================================= ./texts/FBIZodiac5/143.txt ======= AI:'u.tI'n:s'rnM' '.'I'.BLi:?'l"Y'PE ' " ============================================= ./texts/FBIZodiac5/144.txt ======= ============================================= ./texts/FBIZodiac5/145.txt ======= 3 {'7}. "HM :?'3 -1 - I_ . 4' Rficagflég FflHEPAI,RHREfi[fflFENVEETMATHHN {@113 71* 1r:~::1'en ST.-1'_E'1E:S_|3IEi*.-'-.r-‘.'J'!=1l'£-i‘~"l' or JUSTECE 3 In _ ' ' ' ’ I" L-n§:o=n§t>+-r W0-R 591-331 E0 LE8 FILE _ 20:31.:-AC ' _ “ - . '- "' R“ BXTURTIUM .. . . _ . 949911 """_ "' DU; Sacramento " -- ‘~ - ' D—?&G2UEfl9Q LL ¢R~ J’-|1»5&"1' "I.—:i‘-' E-3 amillat i.\|_2|_fl5 Tcqueatad by: S-an ?J?5It_§-3'—_$CU..‘.'_{_H_—_2-2'S|E- airtg} 2 ;"BJ"i'Ll E3am.lnat-innlgquétéd: Decumen _ «. '“ _ ’ *- see received: zranu V _ Examination; Refillil Ir? E’-xaminafion: ' - _. .. :1.- " ISPM Ga. '52:”-' E Wfi‘ E1 Qfl -- -"J?-Z-n'-:_ _ " [QR "' _-/1-.£.- E--’“* _ _ _ C Mm wia. #9 NEG . ‘ ?. mm W VMMQ-0 £2052 Fllotograph of :2n1,relc>II;-H3. postamrked "L§.S.' POSTAL SEREFICE CA 314 AH E5 xD‘..: " hearing the Plant} printed address "San Fran. 'C].'|.'C'EH|'!i'-.‘.3.'E'_. Please Rush T-:3: E11" Qt‘-‘Sé Acflmwpanying hand p1:'1'.fi:El:1 letfier beginning ‘_'I saw c. '|:hi:1?*-:."." ============================================= ./texts/FBIZodiac5/146.txt ======= circa-210 [J‘2$-5|:-J " ' ' ?E?§3“7Kxx P-i.<‘§XXXK IXXXXX L B'IJ'RE¢UJ UF G$flON FCIIFA DELETE-D PAGE ]1‘FF'DHI'I‘L‘!LTIUN SHEET F‘936{.=]I W'ith1'I€1d. E'".L'iJ21}' 4! IHL1 lumfiun in the file, % arr mm 9? 1119 icIi||.n-wing suaaemnbe-. were inilcaxedj anplaln Unis 4.B|.-man. U D&1et'L U t't|}|{3) U WE? El II¥}2I[5} U {W29} [1 I:}:3-{Ff} El Iibflfifil '3 E'~'<}'['T} III Iefnmwtion prxrtaiul:-cl Ugly to 9 =_E11'Jd party with I10 reference to 1.'h.3 suhj-sci of your l'2EJl.'IE3[ ed‘ the subjmt of 3-uur request is Ei.st-°.-d Lu th: titl: only. El DD€J.1o'tCIEat3 Originated Wi1h %J1.0I'.e?tE‘[‘ Gclvtuuuml agmtcyfiics). Thcsc ckvcurwnts were ref-sated to that 9gerJ.I:}'(1'.aL} EDI Iwjsw and dimtt rfipmus In you. Page-5 wmain iElfO‘lT.I:|iIi.£IJ2| éumiahead by another Gnvmmmi agaocyfitsp. ‘mu w-jlituc a.I:'1‘s"15ed by the P-BI as 1:‘) the mlr:aaabiJ.iI:}' oftbbs in.fo1'n';ati.on fn|JJ::t§»'i:1g:ruJ L'.1:Iu,5ulI;aIi.ou1 wllh the other fins}-(ins). Fag-&[$] wlfllhcld i.1'JasUI.u.I:h as :4. fmal rel-sass d.e1E=rI'ELi.11atiGn has EDI: b-Earl 01-ads. You will tn: aliwiscfl as to Itu: -:'.i;51G-sitinu at 5: later date. at“ P6335 H-'I:J:I= IW1. cuusidcmci fur n'J.sas3 as they 31: dupljcatlvs at’ 1'-" ‘F993:-" -I af E §.& Page:[s] wi,t]1,]1sld for the fnllowing reasotafisjz I3 The iclilnwiug number is to be: used for refaxencc ngaxx-1i.n,g mm pages: 1493?’ FF’? #5,; :5 G 3QSIX§'I3'5X}G§K§{}U§XXI=E.T=€. X Deleted ‘P-agI={.sII X X No Dupllcaiioll Fee )6; K for this page X FDEXXXKEEKXXJCKXXX XIGDCEX FBUDOI ============================================= ./texts/FBIZodiac5/147.txt ======= .'v_r.,_<; : TN-I I /. '.-.- ' v-rigtsfirfxrz-'ut_&r ' ‘|_- . 1 \ “v-_-_ . ============================================= ./texts/FBIZodiac5/148.txt ======= LII 0-11! 03.1‘ nr":uyg§jp‘nJi}-m‘ ‘E’ ============================================= ./texts/FBIZodiac5/149.txt ======= . 1 -iecorded , 1 EDERAL.BURE&U OFlfl?EST1Ufi§fi7N I‘ " 3f*§.v’?’.'z ITEEI 3Te3cTE$ DE.F'.s9aRTMENT EIF JT,-MICE 37,1 1-TO LE3 FELE La burns: pf ‘Nu rls 5hB%|‘ -29911 ~—- Rg:|%gDt=1.|-C‘; _ ~ F5135 E- :=»2<«T03T3UE1 Lat>.# n—*rc;I:>3r.:<-.035 LL I30: 5;"-.C?..~’L-'-E1-?*i'€J SE3‘? F?m%.I‘-ECZSC-D EEl—3B“.§"-31' ELTL:"{;'33. Z/Z537‘? Date received; Sfé/_'T-<5 Exznmlnabion requested. by; 555'-'3: E.-uIm'L1Lat-ion r~e—q1._ua5t£:ci= 5'55 ‘-531359 — -- _EeaflhufExammaJ$$ - ‘Id Exammlfienby up 4/,?E,r_f55,_§g__C:~’7r,3l§__<; # / ; 4**~*~ % 3. .«,§5’aw’~—‘~ C353555 /’ QCSQ ?hutocopy Bf envelope pcstmarksd "U, B. PCSTfiL SER?!CE, Cfi 913 Eg §~}E$ 15T¢:” bearing the hand printed addreeg ”EHitQr can Fr nciscn Chronicle San FranBiSC9: Ca1ifG?flia" QCG5 Adfiompanying photocopy of fihest of gaps: hearing the kfifi bani. Qrgnted message beginning ” 1: 3;. Editor, Did you knuw '['.|.1fiCt t§1-3 . . .“ E —— Sacramflnto m.,_~._,..,,_w,__q__=«L ________________ _Th..,__.q.,,_,,_W_e ============================================= ./texts/FBIZodiac5/150.txt ======= u;PC:.d,-,—1|:I [l2—3—!fiJ ' I; }UDCXXX FEDERAL BIJREAU OF &HGN FOIH1 DELETED P.-H-GE l1"|'FU'R.Tr'[A'I'IE|N E1‘ Pegellfl Wlfiflwld efietifllj-' at Ittix locaiinn in I1:-2 1'I.1I:. One or more ufths fioflon-533 :Ia1.n:mn.ts_. wlme {11,d.ir:a,wi_. estpiajn this aelatiom. ' El Dalbtions WM8 mad: pIJrsu.aa1L It! the J'.n.d.i.cat2=d. below wi.1!1no segre-331:-13 maiarlal available fen,- releazs L-:- ymt. Suldon 552 ' 5'1.‘ [1 U1}{I3 El fb)I.'J‘}[A} El {d](5,'I E] Eb)??? U {l=)|C3‘}I."3]' E‘ *1iI'@} E1 L"t|J(3J El I{l*)['I-‘J-{C} El IEJE1} _ I3 GIHTJCD} El -[l:]||3} _ U EEFHTJCEJ El -[kII(3} _ U Hill-I.‘7J|2?’?I El flcu.$u]t3IiuU. win: the uU:I.L'41' agecnc.-y~{iss). Page-{$3 I-id:I.|:II:]I:1 i.13.asI:rI.uI:h as a final release de1a1'nai:|1a1i.cu3 has not been m,a.d.e_ Ycvu yu-j_1] hr: a.d_vi,,;|'_~d_ a; to 11;; :1"-spusitiun at z Lain: dam. _. f Page: mm: out n:.ousin1c:refi ferrflease as they axe dup'|jI:a.l'un= of -I. Ig_-1'$r,.I -175 M g. F 1 . Pagnisjl I-ithlauild fur the fioliuwing rca.9on[.5}: EH 'J'h.c fcIL|n:r9ri,1gm:n1.EIccr L5 to he used for l.'|2‘-‘fCl'\Gl'l.DC ;\:ga.ncli_;J_g £1315: pages: - 4 ‘I1 ‘KY1?!-gzf PM?‘ XXK Efl X Delabefi 'Pa.v_tt[$;I X X No Duplication Fa: X K for Uni; page X XK.i‘i?C?C?C€.F*i'K.3SDQ<7r'-"1:C-"\$I'€ gH,,m5mfi,,n,eu.m..fi; 1,3,: SEEERIEF‘ UP SULHNO 'I3IZ|'LINI“§t' tee‘-24554) Ci-1LIFGR%‘TI£11 ' ' Dete :recei1:eu_5:: _ 3/5}’?-|1 E"“"‘;‘““‘i°»’«‘:‘E‘1”‘*“‘E“‘; nocmmni“- H15::3::3="m_=-Iz,:I.~I"I.‘ - ' Reeuli of EKBF[|i.rI5.L'E_C-‘T3-i gl - I V‘ -H E’““"E““3fi°“ 1”“ w A zocéeie, file!‘ ‘/5 H ~Lx%7;L ;_ 3; };_.;'_’,_;jd..g'q’{;3 ffi. Ié 239.5. I - 1313.1 Three sheets of paper be:a_'ri a§:1235;"_1:EI: hand printing at I{1_.2a .11'ee~L;—At l_':L--GI._a.]_'.I¢Q Business Rs-mimaerr notebook be-a.r:':.n - he kncwufigfixadwriting _:'--.'.'.----’-'=- _.= -'.-.-.= of s" e_.1.so stmeizrrnn: we 5:31.11: prints ' E‘ ,Fil-'?rJaca,s={e_<. .' .c:-f='Eu:rl3.rm mm 5' :53. rerznr - -1:: = ' . ._-. . ' = ============================================= ./texts/FBIZodiac5/155.txt ======= ============================================= ./texts/FBIZodiac5/156.txt ======= ' 3."-.€-_‘fi-1&3 _5Irs¥$h: ' fa ============================================= ./texts/FBIZodiac5/157.txt ======= ============================================= ./texts/FBIZodiac5/158.txt ======= .1-. " F ";1=:£-.L BUREAU OF irwEsT1GaTIDN UNETELD STATES DBP&P:T-’_-dEi\'T OF JEISTICE REGCIRIJED rma I-lbfinuhrr ‘furl Sfiezl 1m1.hE FILE Fije. # 9-49EI1l~— L,a1;..# ‘I2!-7-1f2I3£|I§G2l 1.1.- R2: -lad’ }%_<:_;'" ' E.;;45_.5,fi-)5/4;._*_: .4‘-'~"d‘r EL-‘IG\f""'|r¢":JI"£ Exaginatign J-equggtgd 1,3; :31-IERIFF CF SC'L£'-LNG CIWINTY (5-‘Y-24554:} CHLIFGRNIA Exmuinaslun rauuee-Bed: 1:3-.3 rgggi-Fad: 3r'_.5J?7'4 . ~___ nu:-:‘::uI1ENT ~ F1NGIRPR'.EN'.E!- _ J _ -R&5|L]E of E;:3_u_'|i|1511‘_'|:-'|'|_-| :' ' I I ' - -- --..n Efl£.I?-::|J'.UfiJI-i.UI|. ]>_'|": ,__ 775 2 ,.;_,L éflqi. é fiéfi / M flu " J» % ?s%‘f$‘ E11 Three aheejs of paper Jggfiw hand printing of E1} Week-At eh-Glance Euainess Bea;uinder'uc:4:-aeboc-1-: ear‘ ihi knownflifiwriting .-.,.-';.-'.- _. -=- -. _-. -‘LIED ST.|'HqII’1'I'E.‘D: Two pa-.1111 print pin c¢y-h; of SD 3114:: nun 31 Jailfrecordnfiawm‘ _g:r1:a:e.c_ - I g._ -— ~" SHERIFF'S BEP,a.g]1-HENT c<>w-rrv cur s<::L.n=.r1In:.: :%$':l'-I‘-|.T|'$ up g_p,._.F¢BNm $9.,-_n.. - - NJ?!) - . '5' |"o|r-‘I-zld. C; 51533 ' V-Illeio. 1:1. 94.59.; "?T.|'."‘12Z‘r.‘|2I;u' ?DH_n3;_4'M I 550 '.|'-was 51;. - ‘ En-II:rg.c TEIJ‘-4122__',I§qu -' £35-cu Vlrglrlsg 331 -' ============================================= ./texts/FBIZodiac5/159.txt ======= DPCAQD {I24-HHII '3 E XXZ3'C-‘ODE FEDER-‘KL BLIREAU EFF AHGN E‘DII’!I DELETE-D‘ PAGE HDN ET ' WEOFFJ Wi'|fi-51-C191 ‘=91-'5-D51? 3-1 U31-I Location in 111: fi.'|I:. One or won: oF!1v= fiollcvwinignmccincots. when: 1'.n.d.'u:1aa1, arrplajn 11333 dalatiw. I-I Deletions were made Immrmat to Use axmzggrdona imlimeo hr.-5.o-wu-in: rm sogm-.ga1>1e mam.-ia.1 2:0-21,i_1a3.-,~]e for mloasn to you. §. I:r cm} no {bJmmJ 1:; (ms) :- mm :3 {|=JIi?}§11) o (win I21 -n=:u-:s;u E: Eb}-L"?}iCJ I: man- I: |Ib}I27Jl'D]| :2 um) I: ib}{’»'J{E} cu too; a mom In mm D rm-:43 U cbnca: o {k_‘.-{5JI In macs; n:: cu:-:9: I: was: I3 -ib)i'5J a cam} U ilofwcoaxion pntaioofl oolyto 3: uzuro party w'.'IU:I no ! to toe gotujeaa oi 3-'oru1.':I=qIJ:sl: co the subject ofyour request iSii'.'£-'|E1d. in 1hr: ritfc oaly. U Dflwmwfis U1-'igi-113%‘-Ii wiflru snclslaar I30-rarmumt =!-gt2'D¢}"{i'%:]- Tb.I=a¢ do-cumcuis mane mforred ta shes ag«emy{i.-as-) For J:='v'.i':w aod oiroci mwooac to you. F’EIg<°_5 Emltain L11fom:taxio:ri furoisbod of mm Gom:-.t:J.ment sgeongrfsate}. ‘fr:-an w-ml,-.u.: 3.1:.-iwd in}; the F51 as T0 312 r2|ea$ahtLit)' (Pi L]1.i:’.~. i.1|.fi¢II:I:oatio:1 fioliowiogt.-«J.r oowxoltsxioo with ma orbit: =5c|7:':_'{[iA.'5j. Psaflisj s--1'fJ:I.hr:Ed hnasmucn as a fine-J J:EJr=a.-51: <:1<:tca'u:I.i.13-axioo. has not been mmi-e. You wiflbe adyi.-and as to up; disposition at a later date. If Pegs Wcrcnotoonaidczmd formal-sass a5L'I1-ajranz d1|:(-u1i,<:a.I,iu::;yE E—Ef¢'i[,f- fir; .3 ?“3§fiE=} '-73«'i.t1flI.=J.tl for the following n7.a3oo[s]: W TM fifllowéog nLIJrIb<:I.' is to be used. for refszsooo 2|'\$a1'\d'l1I.$ these: pages: : 5.7"-&F‘?'i'.-'f~.-'3'-:3 /J?‘ KXHK3DF KX x ocrmcl 'P9.gc[.s) X X No Duplication Po: X K for this pag: ?[ 3(3C}{?{}E:7i§C9CX')i3§'3(X3C}C( KXXKXX KKKKXK 3‘Cx?”’U‘35- FBIEDCIJ ============================================= ./texts/FBIZodiac5/160.txt ======= ' :. 0\.D'flDIW-|L|-'\0F\.Uuh.bI . 2‘=‘.‘.';'»r°°-‘5-.‘3"a’.T§.“,.; ...._... 1. £1 ., :3" 3' UNITED STATES G-%11,h"Iu{1i_‘._!*{"I’ '_ Memorandum . TD =_2:I1nE‘.cJI'oH, 1:-131 r;9—L}9g11;L {;st1:n: FBI mu; -!+_f11./?1+ boratary, and Iqentiricati-an Divisic-I1; Latent Fingerprint gecti-311, LE #fi-1'301l~2} arc, Les p.z~IGer..E»S {62—S3'j~?-L]. {3e>)_ :53‘ suBj:.c:T: EEDDIELG JHTORTIDN CID: Sac ramento %{¢,,_ w___ . __ _ ?é=$I:;a2rx.='? ffififl W "'ge\5acramento airteL_tp Bnrean_fietEfl 3/SE74? Q,’ - Enelneefl for the FBI iaboratery are the fflllefiing: IL. 'I'h.ree 33-," :-c 1]." 1i_ne]_1ce De_:_Ja1'- ant 13:! the Idegtification Division on .'L1/flffifi, latent Cate #T3996, with ether latent prints on previously “_;t,guhm1tted $ampL£fi by the Sacramento and San Francisco GffiBE$- -34- .- ============================================= ./texts/FBIZodiac5/163.txt ======= ============================================= ./texts/FBIZodiac5/164.txt ======= IIEPCIRT of the ,--x_ x'\ _ ' .:=.n£~t. I..|nun,J|.,II_-an! Ag; - " '_ n-:nauu. Iu.IIt_u__u uI_= mv:s1'1n11'n&n_ " ' ' IiwI.s_I'-ulI:'1'oH; D. n."':u5:5 ' . ma£-1a':'£a2—n.IsuJ'- " - ' °*'=~'= rm-*2 -lrnir-2 _ I ll. _ PEMFLLD: h1o._ _. " " = " ' “”"”°' Is'asIsi:§1':r« '54:;-Ema ============================================= ./texts/FBIZodiac5/165.txt ======= s _.e .-..-~;2§< " _:S-R-'. ============================================= ./texts/FBIZodiac5/166.txt ======= ============================================= ./texts/FBIZodiac5/167.txt ======= 'r_g_. -P, _ _ . ?_,_.:_\I’ ‘ '«-..* ‘ ' ' - ' ,~ I‘ F";3"""'E]:|ER-"tL; BURE-‘LU C-‘F INVESTIUAT-;j__iJ t _-: '; WEED 3"1"&TES DEF-QETHENT UF JUSTICE 5XEf'_?_a ‘ iffl Recorded 5;’-C?/74 LEb:n:‘2:|m‘p‘.BIlri. ":1: Rene-ivfid K5143 FILE “'9” xlonwa ' min? “B: g..I;9s11 ,5 axmnnnst - L“*'- Is-'.runa22a1-.t LL DD : Sanmnunto ' ‘ -~ - ' _ _ __ _ _1-c#.a.—1o::+42 , E"“'“""*“""’* "'*'“*‘~°~"*“ "3" Lo: Ana-in ca:-awn littnr -nrunu I E2saInE1}a_i.iprJ re-£1:15EEib2‘:¢‘. * __ _ . D5” I3EEh'E‘i‘ |1.f:|_fif'_I'_fi .’ . . 1_F_______ ; Do-alumni: }’.{11,gffp:I1nt _ N - _ _R¢»5|.I.l|:.'-"0-I‘ Exq.rni.1':ati'1';u'n:' mm " "‘ E”-'-"1"7'-3“_‘3"3' I73": G358 with latents developed in case ' __ entitled - Compare latents developed in Captioned ' - 1.: NG'1‘:Ei'3 B3’: iii: hump p-mm: artisans n-nrvrmszin-mm-. an 3 pg _ L-TE‘ . *3 25¢ tin mu: prrzintocl amp... ' _ "-‘-‘*’!%"!'54*=- 92¢-iffifl-l‘ ' . _ _ _ W-* Mi-3-marina hm print:-at -_IH¢_t “Sh: -.2:-.....t ;.;..‘;;“" ,g.m*-**“*.4aaa,,...'£@:=*=..,.=£';.**p.u..*** -'r.;‘.=";:.....' W iii? h; ‘hand p-I:"':I.ntid usual‘; hgginnigg “mtg; hm-_| w9,'__”t ’L="£i” -229“-:1) - - - -- ' _. _ _ 2- (?G—¢ 9 I {"7"}... Q}-‘g ;’- ”§'-2-.a3:§;.:’ ============================================= ./texts/FBIZodiac5/168.txt ======= % __‘._'_*I--.__:_,; . _ I-_., 3%? : -. Q'J'fl Anqnnpunring 2l1.B'N3-]Jfl_‘]I'.IB!I." alipphzg bearihg jphflr-l:+3_a:1*I9h V Q':"i;.1':!nve1ap-1: i:¢atna&k'é<1 "ifirsnsinz-,.'_cA. AFR an PH 1sE_?#_' ' ' 4 begin; the hand priniad mid:-an: ‘F3333 En'l;:1*p1"'5.8I ' - 353.2 '.=.=:=J-s sweat Rivariidn, ¢a1i£o‘.:'::I.i.al" M12 Ana.-zinpa-n:a-Lug, hand -pg-5.:-.*.-gt:.'n:e:_:§e'i_§5-e _3:-e'_g1n‘:ning -"Raid; _t¢-pit-‘fl -v|_'!.,'_' " ;ml;f' ' ' 2.-n.d:r+aua.?nca=:=t._e'_Luz;'=:zr+:=:r; mg ._ *- q'—;_a_., '_ ,' Egg‘ 5,.-fit." figs. : I:’..r1L£!' - §'.'j'i_-jra-'::nn1::_y=_‘*-_.,_'.---;'33~\1I._f__ _ E‘-1'3"‘}-:1. '- ' W __ hré lmlvpian. I::£"'ty3:-en1*1tto5a :llI$JI-I$:; ' ' ' '“"‘ -5 _ CQHFEESIDH .353 H-fi5_Y_0UflEu---9-J" - >.., ~ --=--cm.‘-,L, ' ‘P’-“*-'|l55It_':'!"_:. Ewe photogn of hand tLu|'oa1 d-uJ=- tw hI=Ilnw-51='l’- “= “sick _or ‘Liv , um-r.‘..11in_g _-gnu " ' -; _ - prov < 2-». '. e.’- x I $6.9. H/mg) ' - 1 z. -I ‘-:‘a.... ."., ‘xv _‘- '_ "-3-. .-. -;_ - ' _' - \' Q~ *-vr— ::::=\': H}; ~. - ‘w.-‘(:3 ._ . ’ 3 ‘\-; ..fl_\,_‘\$\_ __ , .-__ ..'..‘_. _, __ . .. __J_:a.. ..e_ -L_4I—.-t..e___,-=._.\.4.. -_. .i_\_—._1__._.o.. H... 7\'—.. v-\I.¢._,‘_-‘. Examinatimfirn-ilompleted ,P’Ej’{';*& fig "- . .- . - -- ---'--- Time _.- ‘ '-=’?v;=<,\ :#¢'_<= ' r’5’ms.'u.%-'5" ============================================= ./texts/FBIZodiac5/169.txt ======= r:-lvcmn (22.3-.96] KXQC-ins’. FEIJIE-‘.I.:!lL HIMAU GF ]1\TV'£SI'IG-ATIUN FGIIPA DELEIED PAGE ]I‘{FU'PJi'IA'I'I(3N SHEET Paga(9.}u wimjsam an:L1':15' 2; 1:13.15 Iowjan L1: ma f.1e_ (Hm dd‘ mm»: afmc fallau-'tn_gstanemag:3_ mm j_m;1L¢a:_ga, explain 1£hL5 dflzfiun. El Jlaieiiuua were made pur-511311.: In 1116 axamgninus ilniiwad beluw 111111 13:: saagragahla ma¢_e1*'Lal available for ::I:lc.a51: to you. Samoa 5 ' E-:-:1 552.1 In -::n:ur:1:u n ft}-l.‘?J(-°-J Er «ccnm n ct-:n:z:v 1:1 names: D array :1 WEE} 13 cwmccrr U mm _ _ :3 gamma :1 cm: _ _ tr -:h-may :4 may _ _ cu ru:-rrJcFJ -:4 mad} :2 cb:Ic~a:- E! was) an nu-:5: :1 cm} a rule: H mm} :1 nu:-(63 ' I: am U Ittfarmnfiuu pertained only to at flnird part? withno rcfctcnoc to rJ:u= 5:11;]-22:! of you: I:::I1_'I.I.e:.~.I or 11:: subjm :>f_-.n:nu.r rbqusst 'rs1iste«i in d:n= fitlc 03])‘- El fl cIri.g;i:1ahe1d. with anorluar GO‘1r'E“tt'J.Et2II2t:It agmqriits}. Thmc do-c.umcuI.s ',.vI:a_'c l'CfE.Cl',I_'t'd in ma: aga1;cy[ir:sj fur rm:-.-"L-2-,4: and -direct raapclusa to 3-we-:1. i'ig€=S '30|It3-i-El ii1fO.U£I1-3t.i¢a‘|. filmlshfivfl b'_'r anofibnx Gwcrnmsnt ag':.,:Lu:3.'~{'L~:s}. You wiilb-c mi-risni I:r_-' the FBI as tn the 2l'B}B=il5-abilit? cfthls i:rLfou'n1.:tiou -‘allow-'i.1a.go'ux cuusulwtiuun -r.-;-El: U11: crrhc; a:_gtI1£‘)"{i.I‘é‘,‘I. Page(3}wiL1xJ2~s'Ié inasmuch as 9 final Ieieue daeteraaailcminm 1335 mt haw made. ‘mu will]:-c afiabscai as ac: um E"-i.5p-osiiiuu a1 a iawr dabe. «-9 Pfigfi Wan‘: 110-1 ocwsidtacd fur rcJ.:.a.s«<: as they a.re duplicafiue m’ 97- ‘f".F's‘r,u".-‘- ,I"§.;'.. .5 E g Fagalsl vr-'L1J1J1sLcl for the Eollarwing rtasonfisj: - '23 Thu Eullowtug number is 10 be mad for referrimtt rcgasdlug thus: frag-5: _ E:»Li?~_;v_«11;_ _,_.._ KKHHXEHHHHHKKKKK X |:?€lI?E?{}{}{}€}€3€J<'K XECCKKK I={){'J{3{){>( XXFXKX I-‘amz:-I ============================================= ./texts/FBIZodiac5/170.txt ======= Igcrnscn DIRECTOR," FE-I {S4-'-I-99_'I.I|.:| . FBI InF:BC|F|.ATC'RY,'.'_ DflG'LMEI'l"I'-‘xfi :v:»En1=r::_1§-I_cs_.T;r_{>:et -n11r;s::un}':- ' - - _ an-5 .._, P-3 fi EMS -"-- " . ' _..1.L'5.ve:i:iu-'u':-uimi.-'-it 9;r']n'1l:nn 0:21.: ':_g5ra__—n5a.:in' ._ _—' _..'-y-u_¢.M' ============================================= ./texts/FBIZodiac5/171.txt ======= I-IE!i_g.‘§1_.t ' Eire:-: 1g'a:T_1j_: _ , '_',|2Iate of Bi.:t"!‘.h:"-- Place ::u1‘_ Eiirth; ‘ E. N _ Em-_1.-.1‘-.a" ''i%?'‘:|.7gh't_ 5?: ?f%et.u:eE,‘- '\-L‘Q .93 ., ' '5: ' fl¢£afirs£tE§t1gg<_£anc_1___; __ '*'__;a:‘B«_._ ,_ g':_ s1'n'1i;E___r t‘.'.E ’b1J.'.f.1: _ ============================================= ./texts/FBIZodiac5/172.txt ======= .---.I'E.‘£-:1.-]._1:3E-£~ -f:<:_>_ -9.431:-B-.Efl:3j1'::t¢;-tJ__-{.f|.i‘§;_iA 'I;f;e'.'--_a2|.an' '__,flh'e,_La:b'-:r&1?'ory_‘:_ _ - _:'L$ -rEquea‘t€<:t' to -rét1.1'r'n'"fitv']3:l,e5r§e1a;1d'€‘Ehia'“p1ast1cj'foldef With the girizzted metarial. , " , , = _. -' '=_ The fdb 1:1£‘1ca£1oz'1”D'1v'ia1an-ié'-requeS'ter3 39" ;j_-nggIr-pr'_[:1ts.- 1u1t11;,.-,1atent.s c>-:1_.f‘i;1e.<;-:i.?: _ -. ._ . - Buffi-1,2-,'Sr-#15391.-3|“-:.L= La¢.er,=$'=-.3 Hanna. s_:[:1' ;;§'au]:'_l:$_t-yo S ' ~. ============================================= ./texts/FBIZodiac5/173.txt ======= .~ _ 5:. ============================================= ./texts/FBIZodiac5/174.txt ======= ============================================= ./texts/FBIZodiac5/175.txt ======= ============================================= ./texts/FBIZodiac5/176.txt ======= .-v-., -"- T-3 - :3 .,-. '\w'=_°<'EDEHAL BUREAU DE‘ EH‘--'ES'1'I13AT['n'3fi RECGRDED Lwrrzn STATES DEPARTMENT OF JUSTICE §I1sI?u Jfm Lnimruraly work EHEE1 NU LAB LIE *-' P~'3‘= zonmc We "' 949913, J EKTGRTION _' La” rwnaslsass LL CICI : San: f5.ll'|EII'-l‘t'U ' - Examination requested b:r': Cleveland (9-25-it 8} airficel RES}? ‘-5 53:79 received! 9,315 j'.I'q Exa1IIineEioE_r_Bqu35tEHfl= E-r:u:'.u:nu¢_-Fn-I: G E‘in,gEr;§J:=",in-I: ' R-|E‘5U]tDt-E-:3C3.ELifl9t1:;2I-U; Examination b _ H J, 3 J/, _ fliafifi, _ J” K13 Four Sheets -‘hf gag-at‘ baari g I-cnc:-wn writing of- ?-L3lC| EUSHITFEE: Zodiac 3:131 and photograph raf- ;9- ,3£hc#k%7?u#rJ§§ '33- 5}? l,_ _A}:},__,, 5}- :3--‘31~‘§'6' 3,:-S§‘fé ============================================= ./texts/FBIZodiac5/177.txt ======= -' (‘Type In péarruiuu v gix“ avzal-3;c*1~a::EC:' Fa: _t'9'—499111 (n1¢m;'~r:;jL;BpfiATo§Y 4.7 Eli.-a_¢Ia1,Auem-j-as cum; -J.» ============================================= ./texts/FBIZodiac5/178.txt ======= , *§a_ $s:§422g$ _".'_ jg _ 2 -":rGnx:s..=;s_'-1 - ’ .'..____._: .. c . _\ . -_-:- _ _' _ ' __ ?r"._ The ahova listefl items wet ' he ' "g ' - San Franciscq Division by Inspector ‘ If-flruicinie Detail, Sam Franuiscu P1:-lic agar an .. A‘ Q _ - -hriginal oi the ahoYe_lista& itfimfi as 3viden:e_in the aflqdiac case weze proggssed by San Francisco Ea1ice'_ I __ W . e§at§E§.t't€¢hfliCiEfiS add are b&ing"maintain¢d hyfithgfi "" ' ".l%§§'|;.JIEEEl$C-‘3tJ]1.%_‘I3t,.-:,.__.;_::,_ .. ,- . -' ‘_ - . '. wn?€é"§§§‘?”pio'-.-o~ egg; tted in'capEianed casg. for tag infinzmat ja_¢:y,=itawil1 be-ne&efi,¢haE-Insgag; ============================================= ./texts/FBIZodiac5/179.txt ======= ============================================= ./texts/FBIZodiac5/180.txt ======= ============================================= ./texts/FBIZodiac5/181.txt ======= .—i'-. ‘,1 "12 Q __e' - D .2 s’\ EEEEEEE T -=E;1:'Em!.L BUREAU or ]NVES’[‘IGAT'-s=...~i jfm WITEU STATES |3|EPAE'1"ME§\T UP‘ .-JUSTICE Lnhumrnry 'l.'|'o;k 5hge+ Hg L,-_\_3 FILE _ _ . _ 5 Re: zammc: P153 if xxgxxza 2--L_asg12.f_ EKTEIRTIEIE-I W” 1:-—wEus21n319 LL. U E}: S a-:r'aa,2'1'1'l':r.;v - Examuafloumquzmdbyz San Francis¢o {9—22QE) airtel BJlkfiITH Exami.nat.54‘f’,.*F“=|.‘J=Bstss1? E|c:cu:E'¢=a!".‘t DB‘? recewflh. .Ef'2B"'lT U’ Result crfE_xaTninaLic>1'L: ' Eflmmflmn by I’ ”:??{1 ;;;}c;q~j an Cj}C37 §P'““:?- ;E:¢aJEt4;cfi§TC; R r"-“" (1 -3'" ().'}CP'-5 :""—‘°? ! -:1‘: - - - . #1/#fL¢aJg;V;;ug: w<197d@£“ H . 5;-:1/¢¢'£i.«.»..e.’ MM 3. QCTT Photacogy of anualuge bearing illegihla postmark and 1'lElI|.'lIi print-ad address '=EdJ'.‘t‘:3-1" San Prancigco C'hz'¢u:1_in:1e : San Francisco, Qalifornia” QCTB Photocopy of hand printed letter beginning "Editor r 2'-'u1: Har~-c~.t::- ‘tn-1{:Ec......" mad 52,,-gar‘ -~'_,c.,-* ,3 J l,r—‘_,;2 f ' fladlrksg Egg uF§!g+.:‘:gJ _-_ . rt 6 -‘iv "91 ‘- _ I159 Fhotecupy nf*'=ea~=9;u1;>ca post-'na:n-!-<.-ad " POSTAL s£:1:'.v:-1:3, ca 5 EH5 ? 3 MAE 19TH " bearing hand PFThted address .:5di.t5r: SF Chronicle 5th 3 Mission 361.11 E'I'$‘:’L" JD“; |¢_,.:;;.5‘{...-5 pang.-age $3-It UP I3§*-"7 _-_ ],.mz_g_.u'.a‘-5 _fl__‘,, QCEICI Photocopy of‘ d mg “S.1'._r~s — M £5? .Tt.J,:F.N *5 A" ' : ' I wfiuld likfl ‘E0 express. ,,, , . " ;-1;,I¢' g-,.i,.,ug,J ' - - 5 L é J3) —_5~-- —-j-_T+———-—w-=-:==::xre:~«==:=a=sv.-.*cc_=;?2 ============================================= ./texts/FBIZodiac5/182.txt ======= 3 W/”"£/TV / 2/ WW WW 0?”? %Ciw/¢»d€% % L tfj”fiO ,«/:7/%4‘€ .. - .4-—a— «a'.W°FW9¢°'g"- ============================================= ./texts/FBIZodiac5/183.txt ======= _B_|JREAU OF lH'U‘§IJfiATl0N -* ‘You:-1 r-tL.E -ND. 1’B[,F'5J'_.E§ No. _ _ T-‘*“.‘7£'55“'-"T 53-33 _?§"1}~. I W£3HEiDJFGR'fiFFJ¢LiL uss L5.-.,~ ============================================= ./texts/FBIZodiac5/184.txt ======= 7.2 _ ,__ 2 ‘ E-*EraEa.m_. eunaav E-‘F I;-1=ra51"tn3A'rto:-a 'u.'~rm:::- sT..-was 2:-r:p,anT.=.1_F,'tw up .nr5*rtnn _ jfm éeeoxaea 2:25:94 10:05am -P5 Received erzsfirg. LAB FILE I f.uhnm1u_q' ur|: -sheet _ _ - - 36'‘ mama . I F“? §‘.:3-49911.. EXTURTIGN _ . _ . E‘-“M r>—?u_ua1sa:I ' _ .. _.r B0; Sacraments LC?‘ A ':D9_é2 Examination Ieuue-éted 113': Clavealand E9-251L8:I _ air-tel. &'.»”:'I,'i‘1:- _ _ _ E?lfi.|11i.flaEi.fJJ;.V-;;q_\.-li-Etsted? Daugmgnt -g _§_1'_3.|_g'e'f..P.i,in,t __ V Date m_-peivénf: ' g_;l5J{ 714 _ ' Heiault of Examinéfiun: ]¢g'1C-F E‘“""“j"“'U°“ b__' - -{J11/1.z»uw.'3'°H*‘4«*:«tr=-._ ' J. I. fl/U*{TM/h"&fiUi'fi'9"rfi4“L;P}'fl"5“Ai?9"W:4=u" -¢k...,~ ' ¢“"’?‘i“»':'{*t\’ 5"‘? I[‘.I.-"E-"E_,.-v-"T-f -: £575’ K13 FE"-115‘ Sheétfi Of Eailel’ bearing I-¢r|.-‘.‘I‘mr:1 wt-:'L1::'Lng'o“ .I.‘TLL-:50 SUEHETTED: Zodiac sign and photggpaph :;.f v 'Er.&m'I nation‘: Eomrleted/F-I‘-5"j’-45*‘ g"’L?)‘? ‘E"i~'.“.$-S.tE<'] % /éfry ‘I; ; H—“ ‘N *.—----—.--E'i'E'1'E *-'-"-"-- - Wr?w=*'.*1. Pat eW ============================================= ./texts/FBIZodiac5/185.txt ======= _-2..'.-.'..,..r.-..—-...,._. ...__ 3. I" - -mm ’:‘fi{§ ‘T539 T533 TE-U9- TE M T5 [3 TE-'39 T533 ‘H535 ’i'E25 7517 15,15 °'I‘33€ 75 ET. ‘T68’? T513 ‘T315 TE‘-S-S T525 "T609 "1629 ‘I623 133'! :33‘. ME- * ' mm‘ --_h-I3-as _con-es. J’..e-1u. Unit 5533 :tu‘|2sc.rtsJ1i<:alEec.t'u:s1 5-11:: .17. P.S. $137 I]! E'DI:I5'-M1'da1:iDn ' ’T231 :fis.E3zr.-JJIJ Iocata 221D ['.B:IRscon:ls &cfi9o _r..=:.:;p_bL;- Sc-:F.i,-an 2:11 :2. _Teu:?m'u:9J Swiiw 32IJ1IB_M.r. _|.'.':I:1'e51IIcrIds41-:3 Unit ' 52-33 IE RDICIEI1 3:595: ,a>,u;£«l= /é?‘ fiaefifi AWE ,,6W£’& 5.1% C 1.1 '|. 1 '\. . Ngtq?-gfiutq any ' :5? 3 Nate 5.116 R£’tLl:‘I1 Plans 06 H£I:cIJ.'|fi_ $76 ' 1.?'R.N—' A.-esigzll 1 lurk 7305 l_D'-bi? Fruteaaéna 9291 TB :Mi.-:5 T531} - ]'I']I.i_|. . §-531 '.Ph.-:Ih'.I Unit 731$ - ============================================= ./texts/FBIZodiac5/186.txt ======= l1P|:,‘::'.-2:} E1.‘.:‘.-'3-96} FEJJIIRAL BTIREAU IIIF ]N‘¢"ES'l'IGA'I'I|Il'N DELETED PAGE HUN SHEET FOIPA Pag£{s} witbhclld cxutirtly at I121; 1¢«:asinn in the 15.16. Uflé OI‘ flflw 0! TJIE ffl|U€WI"lIl.B wlilfllfl. '-'r11Ed.'6 id.r13:as!r=d.. explain t]3i.s c1.I:Jr:titm. El Detediuns ‘H-'\'E'I,'E maths p'Ln:a'L1an[ 1:} Che. eau*.mp‘I:ioas ,-cjnasc to ycru. E] E] l3>}E1} E31353} rn3[3') U‘-CIE4} UJIIEFJ Eb){'i| afiflefl Cllf][Z||'.'l[C|II][.'JC2 iI].fli[.‘:2l'[e!i bclc-w wiih 111:: sagmgabéc Iuauccial av:aiJaa:.1e for I:taJL‘I1-Is») '3='JCT}[3J (WW1-{’C—'.' I3:-JETHD} I3:'}|LT1{EJ cbJIFI-BU G?}|.'3} WISE} §¢CtiCIEl- % {45JI|I5} '[iII[1Il W11} 'l'|:'.||fE} flI‘JIC3I' $314} 'l'|=‘Jtfi} fkjllifi} E|E|E|E|U|'_'1UE|U t'|<,'"i7} 1:| Iufuxmafivn pestamed only to a ahjn-.L pslty with no Icfcrcucc to the subdw :If'§'n:ru:r mqimr cvrtha subject oi:ru=.Ir Ioqwc-st is liflfid 1'51 the tiller univ- EI D(.I:I.1m:uLs cvrigiuamd with ms-111:: Gurcnuumr a.gt-cutylfi-as). These dn-aumcuta wcrc refund in that =,§=n~1:F{it3II fur I-ev1'cw and din-I:I. IE-'pl!|E|-PC DO you, P‘-ages oontaifi iqfoumaflou ixzlmiabui E13 a.|:u:IL'|1vcr Gu=n:a:u.u:I:1:It flgflil-|1'_'f'l:5E:I. ‘(D13 ‘-'.|'i.1H3-E: a_.d\-'i.$E1d byths H3135 to the 1<:E<:=as:a1:uiJ.i1;q' -:If|'.'h.i.i u fuucvwiug om: UWSIAJEHIIOO. 'P«"§.th.1hE C|U1€»'!.' 21g6111C5"{|-ES}. Fag-s{s} witbhcid Luasmnth as a final rdaasa detarminmlou has nut bane: :na.d.c:. You wjli be advised as to me dlspusifiuu at a lztcr t£a|:c_ é Pawgv.-.5 were not Guusldcmd f=?fJ'|'flW.’iG as E16} M0 dupllcaflw tlf f'jf1?I",f‘ [£2 fl$5,t F 53 ‘P-Dgefis} wichhdd in: the Eo1JcI?«'in_gn:m:u:II{s}: I3 111.: fo|]cxw'u1.g nurnbcr is U: be mod f‘-1rJ:=i'=.rI='.nUc J'I:.§su:diu; Ihme pagfitfi-I _ ¢?»<:'1-wr« grs‘ mp: figs _____ KKKIX XX X}-1}-CPR XX KIKKXK XKKKJ{K}GDQ€ K Dcluad '_PiLgI:[5} I X. No Duplication F-12 X. X for this pug: K E‘C?C3C}UC?C}i}§XX}<-_X3Cx3C E"|§|-'D|}.| ============================================= ./texts/FBIZodiac5/187.txt ======= F El -35 I11 I.-v- 5-1'3-E43 Du:-2: I I I I I - I .FB|' '. _' I ._ I i' I I I I I'T:r,p+: I'JcI .p£'ru'nI-ax! an’ ruxfci ,_; Via mm; I _- - --|'F.u'o4'I'.£}‘:' — ; _ ______________________________________________ __.L.___,_,_.___ _ - DIE'.Ey:- ' '_¢. - 1 Evidence noted 111'. J . M J? roé - '3<“°?l!r:s-J{_' 3 2:; am :31 r«/; 1 $3 ~ ”“°" ‘ ~*~"“='”€%‘3“e'>~’J WM ' me, 6 MM fa/{gag/WWW Ex z.xa»:4w?-=w- F I ,.4,:,: ,H.«m..,..JM :;’f/“‘7”‘°' H r/3% «'1-fi"r~njyC1r-5" -F ?}’_;7“-;‘- <2-*1-r/v-A-Z-H .*‘_ E=='""!t:'%=£i|:<;"h:-1?-v::~Efi"/—T.5E—fi—zi«='lr.’ 63?’ #3 ” 7*’ Uictutad )3 pDqe;=:,57 E %wfifiTWm%_ V J! ============================================= ./texts/FBIZodiac5/190.txt ======= {I3-yg :'n 7:.“-.fnI5-gt pd’ 21:44:,‘ .1 - ' DIRECTOR, F131 (9.~495?11)3- . .; _AT_*rE.t»1;I:m_- IDr.tjIrz§1I;c_s».:r_IcmI ._mv -';Ex1‘oaT'im&f -:_c:«::r * st:-= '1.-_ 2fJ'.3;";:'5 , 3']-:+:é'-'5.-e.cE1.;.'i~=.1'*'e' Séfgean o1icé.'~-‘J11-ep jsl1i:tmEnt';'<'a::_l3J;’;s'-éai»"t1'£§.t f«~in‘§5E:_,§2_£1;fi§.qJna~::a _. . .!|.... . lie-‘£33’ '_é1§:'Elil't3’?"’;=‘J5i1"1té"_ ‘ hj.3;_11;attar E'.EmE5'E"-|l§IF:'BU1iE1!LU' ' «E. ‘Wi.i_ilf"—‘i:'e:in1!“;*'_-_ % L 'b‘1'("§:gainst tinge:-prints 5f ' Sacramartta will e:5:,a1ugiuaLj.c:n'.=._ Eflt in CHCIREIE -- '- I L:'5.J3-a-\.~Im-_rn-all FI'fni:ln-3".'|'|'11-.=Iu: 15.-3'2.-— a35—25?'i' :_jj_-._,,,._,.,,.,..,.,_,.,,,_,,, ============================================= ./texts/FBIZodiac5/191.txt ======= -' 5?€{E5-fl1%Ev.3W' 15 %~'fi.=fiI§a5 "1_'EL§1'P .£L‘i'» ssoaie-Y ============================================= ./texts/FBIZodiac5/192.txt ======= 3-25 [Fl,¢v.\ 1!.-8-511] Q r - r . . FEDERAL BUFIE-‘RU OE‘ ENVEETIGATIDN LATENT PINGEHPHINT SECTION WORK SHEET F'""“"‘*"‘*‘ 2r'18.»'?5 10:59 am. 11 §3;fl”f:i‘}:“,j:f“ 9 -53 9 __ Received: ' Latent Case No: 9‘49911’'_ I 3:] 2,#1sn5_ _ _ 1 A» 101342 Answei to: ' - - -- - SAC, Sacramento Examination requested by; Addrefisea COPE‘ in: » ' ZODIAC EHUMIGN -- .- -\.'- .- I (I; __]_I_k:{e of Iefe-range somlnunicutlon: Airtel Z’! ‘]_.!H.’3r5 - ' i-r_h?’?_"°-"‘:""‘"‘°"‘:""‘ Nasme uhmitted for c art on urp:=:=js: :( -V :.,-u«~b““°B= ;-- NGPF ‘. FEIJ? I If \. - 1 Result of exéucminutlon: 3, §:?£5:l::i:;k];;:bgfi cf. Ma .3 ma! J,‘/-“Er i ?F’¢”-"-“*L C»1+—'—x -C'_$ 3/if 1,,—1<«£m‘¢;a«J5 PW ’*°r"-Z1114? emf‘ F-9*-7""! L , E gxclitflitlllil liuu I:Dv:nplI=eEced _ Dicicicad; L Time ate Dcrt-2 --~_..----..°_°_- -_.._..°_M_....w....- ms v......».-.__. .__.j ============================================= ./texts/FBIZodiac5/193.txt ======= /“~. ,4-'-x ~’.‘:|]='Ca..z{I [12—3-943 : *. JDQQQCX FEDERAL BUREAU DF lN§’E.S'I'IGAT'IG|N FUIFA DELE']'ED PALGE [NFQKNIATIUN SET ‘_;IgE'___ Pagefa} withlsatd cutlrcly ax mt: I-::c:rL'u:Ju1 inlhe 1111:. One acr mare at’ me mun»-remg slalm:-e.uJ;s, u-{mg i|j_di,c.g.|:¢fl___ nxplaiu 1J1i5 duluiiun. ' N Deletions watt mane gm:-sump: 1:: the emnptic-us ig1d3::3t-ad balm with no segxegahle max-m'a1'awa1|;mg fog rcl-zase no }"(?ll- ‘-ms Cr mam 1:1 cbmw I:I can-is :1 rm; 1:: n:J::'?:-I131 3:! {pay :3 {tours} ;I.’cb:U:-an CI M1} txch:-ma:-J El arm} I: mmmum III (Kim D rm-mm u xkxan El {|:IJ{4j El {I:I]I(3) U 1'k]I(fi}' ca (bats) 4:! -MKS‘) I3 ac:-:6} D Co:-c¢ _ _ . --. 3-L" 1_ettar.'_ ============================================= ./texts/FBIZodiac5/196.txt ======= J ‘L2 - "'_"‘-" ._ " r a-. .1‘ . . Lg, 3' RECORDED FEDERAL BUREFLU OF‘ I.“s“s"EST[|Z‘ré':.'?'!-Cit‘! 5;"I.2.-"'T"5 UNTTEU S"l‘."sTES |IIEPAE’P.'riE.".”E‘ OF JLI§T[CE 1 jl.-_ LnahIr:ru1ury wad; 5IIIeEf E HE: zunmc ' File -1? 9-49911 EXT-URTIGN ' _ Lab.# CR-1-5L3£u.? IC- Examination requested by-. San Francisco letter dated in-"18,-’7"5 Ugte race":-_JQd_'. |'-_+,I""2i,u"?5 Exam in51E:ir1».1equrg-.-2-ted: '$'1'1r‘|;>ta1‘s-SI:-'H'EiS~ \ ‘ I"-eaukt of Examin s.ti.o-.'I.: Exfifiiflfiiliflfi 113"‘ [fl Qfiififi :%ufiJ% QEK Q31 %;&5$% Lqmmgw ' _ .-. -._—-f :- _ . _ |".?_ (J'E"'.’«..L.R OF-NEPAL I1-'5‘-B as-me" ' . 5 3 ' ' } ':r5L£'r3(1‘-'5 U1:-|'J'I' |:| _ ' . _. _ ’ ============================================= ./texts/FBIZodiac5/200.txt ======= 97.} W Q . FEIDERAE; sunenu or-' I_iWE,‘5'3'IGA’I'IGN LATENT F'[iViGEF.FH}N'1' 5E'(:TICIN WDHK SHEET REH3INd‘3I1= yr.-“-59 -./?5 E" !’w'-9 9 Eéfij Flefessnc-9 N-cI:5E—[§E5i'. _ ' ' - - 1 _ ,_ __FE1_I1'Ele ago: 9-1,:gg1;___ {’a;"£'~§‘ Hsceivedr I-1-r”2§,-{T5 Latent Case No: 3-19313 ‘-7 f .-111%-rerto: E!-'5.C_, 1.3; Angela; Exrxminmtcfl ;:cqs_.g.aatcd hr: =°|d'31‘€-EEEE Copy to: H5: ZODIAC, EKTGRTEON E "Elite of reference :r.‘|2l'l'LI'rLL151in:q?.:on: 1,:;_1-,1-,3 3- ;§.,J’g3,-"'l‘r‘5 3_DE':I£f|.IE'-21:: : I~_Ia:_u.e..5, _,. t<-_-.z.-;-::;_-‘-i.»;- aw Spa-=iu1.°.§¢n£,'m fihmge . mu: ,,_,'.”,_m_,,,_ . ._‘_ ============================================= ./texts/FBIZodiac5/203.txt ======= ============================================= ./texts/FBIZodiac5/204.txt ======= ;i_;';ggg;+_;.3' ‘§3;:‘~1-.15.-1'.-. is_.;xe.s'g}i=ag arm; 13 A ============================================= ./texts/FBIZodiac5/205.txt ======= LIu|:bI!PI£f 1‘-ununm-n1 F-u-rm T_- - . . =5 + _ ' V‘ . _. 1. ~..__ _ ----‘?.iu'iJH|HlE]"RhTL'I|'E.EAGE ’1'E'|:.'ET‘T§'E'I:IIflTI‘:I '- - ' -. _ ~15 ============================================= ./texts/FBIZodiac5/206.txt ======= . ~—1c:_ I.A1lfl-Rhl.‘flR!' =..F=°s;r¢a 'Bt!ItEI|-i_-..F'F-.-E‘?"E§I!|==*“F'!'-- - _gi_'.l|_.fillIHEI'£_HI, b._ i:.":n:_rs_as - /:.f9-I;-FE-B-1‘: ; L daiéfit 1 594$- -_-»-—:---:-:_~u--ra:j—__—.:_—_ -—....—..,,,_.-..._._ _.. ._ __..T_.._ ...___,,,_,_,_,,.,,.,,,__ _ . :1.\ . . ============================================= ./texts/FBIZodiac5/207.txt ======= 7:3 gag: r" -:2 _ , RECOESDEEJ '%"°‘a'm 5 _ ?—1s~75 - - clh FE:DER;1L BUREAU Ii‘.-F :m‘EsTIGp.T10N UNITED EVTATEG DEIPPLETHENT UF JU$TlCE Lpbnrnjnrp Wu rk 3&1 T°Enc. SACRAMENTO {9—5s} - H. _ _ I no LAB FILE ' ' K" , . » {J F'EI'F'l1.E.NO- LE‘ {.-"6? if “Jr, - L*”'“°’D—?5o?14o95 LL It ~. ' Ezdfliiaa; ' ' ' “UK “'3'- EHTCILFETIDDI "- ' , ' " - -- H ' - ' ' _ 0'5‘ 3 'E:u|'.uinuJ:.iou1 emanation requeahz-1 am 5g.;j3;,§.1E,-_u,-:3-Q elirtal dated 7-9-75 Szialuinaii-nmtsI1uwIsd= ;'_-.05 fpgt ;5pIF_clmgn9:gDgi7gd: '_‘IP_,1g_';.‘5 gar! Slip of paper hearing handwritten and hand printad message beginning “sguxwux 3:33 p.m. ....-" L. «we. F. :«<«-’- r.:»=“re* ——=7 =’7‘";" - L/éflflgr ,;é§ Zoagfmusx, «Q-/Wéi « ' ‘J?’ "”‘(”"f‘W”% Wwmfif ;r:fi:;£,£/2:5 ég R:/I 9-L _,.-;3i:f*'au=: «s'.—..<..» ...-5 - / . , . Hf ,4/? fl‘ .4i€"—;i'? Pg"-av-‘lg.-"/—4v-1.r._‘T-L.:.-.«:-»c*,ca*.2: L?" 4;’ ._, .-.j_';.-‘“" N... —‘ 5 *3. _': - 4 $7 1 .5? flrg ;j_,..r"§'._/ ============================================= ./texts/FBIZodiac6/1.txt ======= Freedom oflnfermation and Privacy Acts SH .EI_,r'ecr.' ZODIAC KILLER Fife Numlrer.‘ §—fl§_3_‘—4'2E £3 SECTION A Federef Bureau ef.InveSt£getien ============================================= ./texts/FBIZodiac6/2.txt ======= :-‘in-*£}rrI.|._ Iufii?-Ii E.P£1Em;Itifi»§‘i_' Wfljiiflilflfiflflfi $E_5“flCT ============================================= ./texts/FBIZodiac6/3.txt ======= —m—«:-v==s-2\$3&I>i'Ivc#5o::»e.-o.=szI~s=:\=~._..,_.,______ / . ' J’-“.' ' E;>E._n_.HI ;};.T1uHf’fiuppgn; 4113;; -a ============================================= ./texts/FBIZodiac6/4.txt ======= OPE).-2!) [13-3-95) FEDERAL BUREAU OF ENVESHGAIIUN FDIPA DEIETED PAGE II‘l'E1JlI1I-I.-EEIIUN SEEEII‘ fagufs] wi.I.l:IhcJx‘.l I:n.1in=[:r at flfis ]DmI:i.cI|1 inlhz file. On: or metre uflhe l'u1luwi.ngE-13.11.-.u1cn:3, where i1'1d.'u:aI£.fi, bqplam this deletion. ' El Iilclctimts wan: mastic 1:II.1.L:I.1.a.1u to the ncwnxpfinms Badtcamd below with no sscgrcgsirlc manujal 'a‘.?a,i,I,a];I]_-e. Em.- rel:-asctayou. [3 (h3g1) E] I£§=}L°2} II] Iibfslfffl :3 chm ta chm- U was} Ei 13 rblmw I3 :1:)','1'}ifE} ca -:3:=)('3'}-{C} Et (b){7J{D} U Eb:-mten III (b}{?J-{F} El tune) in mi?) :."5$3!%_ U {arm '3 -f§JCl) 13 (km) I: (ma) El (km: 1:! (km) E‘ Ilfkliifi) El {klfifil D ':I|=3'I."i‘}- £3 Luiormaflc-n pertain:-A1 011.1310 afluifii parry afiflsmmfrmsana bodzm-a-uiajmtofycurrcquust Iorthfi subicctnfjrour mqueet is l'u.I'.ad i;11J;|.a rm-3 G-I|J}'. ICE II-ocuiuauxs wlglnaxnd with a.|:II:I|:]J.v=I.' Guwemmeut a;g:n':_rFJI'-'c-}- This-1: 5.0-=|J|.|:WUJ.‘.-5 were I\EFfBC|'|.'EFd. Lu that agemjrfws] fur rtvi-aw am 63:23 imponse to 32011. Psgg-as cmaain information f.l.:l'|1l.i.'5i1.9d. 1:-jr a.|'.\mJ1.-:r 'G0'<'fi',D.|]18|1‘I agencgriies}. You will be 3,6,3-Seed by 111-2 FBI a In the relcasahiéiry Uffitlia jnfonnatiom fie-lluwiug our mmnltaxiun with the orJ3-er agaaisyflseij. dlapvqitivn at 3. Iain: data. Pagers] withheld iA13.sn:rud:I as a final mlcasc I:1r.=¢.I:.'1'n3.i.11.aI'L<:u1 has mat blacn made. You 1:-n'J]be aévisad as to the é 1='a.g-:3 wear! an! mnsidacfl fe'J'Ia’=I:a.3I: as IJ:II=_I.' art duplicaxivc of '?* "i"‘3"?.r";I'-"' 1”?! Fag-3(5) w'i':i'Li1-=;1-d. for me Eullowlug reason-3): N “lb: Fullowlng number 5.511} hi: 552.6 fioo.'m'6sI:em:.s regarding UR-$6 pages: }I3{X.'>{Tv(}{ IXXXKX 3'~'-‘Q-"{.'niI$c' h 1:111:33’: Icm - '5-@L9¥,Cgi_{e£erencva communication: Teletype 5-35-75 __§§Eq::irIas¢5-i amg ‘ '=5’5M€'4=~W’ 54'» ='—’/-=-2-=;»f=».« 7w M xfimgj " L ' , E’ M4 .44 (:,~,._.;(_ #- £5.10 Flea Dlt. DE ElXUF|'|i.I|.'Cl'l§Dl1: Exu n3:i.1'.rt: tian by: EV-‘id; n-:r_:- noted I;-- . x [:15 W’ 1 1 ’:‘ - Pg N :‘ I. Examination completed ‘IF 331a-tutga '5; 3: %: |-L'l'|‘€ DEE Elie ...__......_...__,_,,_°_: ‘°" ' T"? :-—.:—u-..-.....-.......:: ============================================= ./texts/FBIZodiac6/7.txt ======= ~!|..&'bIuraIIa-rr '|'rIuIsm.'-Illtrl Faun ' " . :-1;-IL$Ill._1L!|'.'|-:|_|'-Ir" \' _ -"F'5“E|W-'.3!J!'Ffl"'."F $2 - ”-' *‘~' i..=°_m .. _;;,...;.;..-Lt...-.;.:;% -. ~ L ' 5::-'imusra;.-r:v:'MsE ‘I ============================================= ./texts/FBIZodiac6/8.txt ======= ============================================= ./texts/FBIZodiac6/9.txt ======= "~ =""'. _ ._.=-4 ‘. ‘R_E}CDR_|;1EE| FEDERAL BUREAU EIF [;wEsT1G,aT1oN 7-1.3-7 5 Human s7L'.~x'1'$ DEPARTMEHT or Ji.I'SI‘1CE 5”‘ L-:3-o:v:!\1']"w-u-IISR-=.-g_I T“ sac, gm FE'.A_._':-TCIS|.'§{} £9~_2Z£|i} W3 1-93 F1133 ' . . . __ _ if ‘I I FBIFEENO. 3_¥99lL ffigyg’ 1.9.3. :40, R3: D—?5|3IU8J."J'3 LL £@DI.I=‘y:: _;_ ' - . \ Vuynwo 1 _ - Ext-oRr:fm=: _ . . _ __ 570 .. A/M" .S:t:Irni.rw.t:'I9=.Ibqr: "I Btsaminatlom :I'$I?||.h5a?-$d.h01‘J /&““'—‘ " "2’°fié!%mn¢e! Letter dated 1'-1-15 r '_'. Ermiaatimmrsqnaeeted: 13.3.: A J fly { Y $1Ie=='=nr3m receér-mi: 5-B-E5 ;,é’4"’"_‘ %‘'A-’' I "’.F'Fw~ BMW Kclé Persona 1 co: hearin .know1 ' 51$» ea = »;»;»g:. gr/. /:;rc»z4=.. _~—~T~:: /‘gcififivf, /égigff . £;Mi§f. /Jgiéagzad’? fAfi{;fiFQ£gLaféé~- Q. /“R/ct H5’ %_ 721 % «Z5 /4 -M;7l*—?‘ Q’ /’:.’J;°»c‘xz,»2?-v>v“’*“"«*"fi€* J}: 6}? § 9% flL1i”?1B?]fi.3~lh 1*"? % ============================================= ./texts/FBIZodiac6/10.txt ======= ._.;;_=..'?* _n.:_ ' . __-: ' =‘-"0-'2 r_'ur+j:r_":.a.LjU5E I:I.|'1',L}' ============================================= ./texts/FBIZodiac6/11.txt ======= T-2 .1? _ luconnzn "'“' _ W .- ‘.[—15—‘r5 9111 FEDEH-AL BUREAU UF INYEETIGATIUN UN ITED 3'7‘.-°xTES DE Pfi RTHENT OF JUETICE Recorded a.m. Bk; Received ’r,’23,/‘f5 Thu. sammu:m:n_ ts-an _ -. _ nu ma rm FmF'U.1:-:Ncr.g.'1;gg1;I_ L.sua.iuu::-. _ D-75I71I=9fi LI: - __ _ Youlwou new-‘m1c:u_-:3:;2 _ -BI.I||I|.i.|I.B1iD§Ibly2 I E79 . : Exmfiusm ceaareanne-1.1:.-s~= HERMEEO W ' ___, _ Noted by _ ...¢_. . _ ,_____’."“*’*’**""*- n1:m1 dntafl 1-s—'.*5 ' Exnmin-atinurevguest-pd: _ %e mt _ ' 5|';IaI:'UII=:ruI I.'IzcI::i-'JI:d: an sup at papa: hauififi htmu-:11-.tan and mm: pzintnd 1‘.'-W. b'.'§'1»3n1flC -ngtifi 3:33 final-up I-tilt‘ '={’7*C~“*-M-— I-=-1»;-~ 7»/:a‘_ L'I5*"£,4.‘7u.«J‘ gxlalg, -..::' £j&U&;/?/fig __ 5,.” ,g;,.r,,,.,£ 3;/Lr-11../4-T1.‘ é-\ gm Examinatinn completed 55 'r_5‘;7,-~g £3/r {)5-' Diet;-_tedH__fl'/:;“FEfi TIME yam ;'.1'L.. -nu: »§«.».+~—,,,/~,£w»~+.~w/ ,+m./,z;a..,z:',x ' ' _ 63§;»ucu4£4/‘/ _ I ?:t5»~&;-**—*/‘*§*’ _ - 3:’ 5""? l 936:) H 5;’ ============================================= ./texts/FBIZodiac6/12.txt ======= ============================================= ./texts/FBIZodiac6/13.txt ======= /""“1‘ /-'1-. -:ua=:'_'.n-no {:3-3-95; ' 1 PDDGGDE FEDEIRAL .3UKEu'IJ.I' OF E|I‘T"4"E5l.’.[G-1-€I'I1'.'.lI‘.‘¥ FDIP.-1 DEJEIED PAGE !NIFUR1'|'Iz¢.'I'|I{1N SHIRE? E'a.g=II-$31 W‘.itb.h.t'|=1 1==1Iirt1}r at Ihis Inc:-Itinu in :1:u= file. 00: 1:»: more nfrhc 1i:alJ¢nritJ.g-slarltamnms, w'h-was bu-ilcama, explain this d.e1e1:i.on. ' El Delctimis ww:em;a=d.e plnsuanx Wlfilfl G inI!hc:a.ta=c1be§uww'i1hI1¢5fi1"%i%la ma.te.r'La]'mraiJ,ah1u far relcasx: to fun. EEEPJLEE. Eagéfla. U ('bII[1} U 1'bJt'3"}{-'5} El {dJ£5} :: ram: :3 _-a:3u:r}r2J El aim El lib}-(3) El Iib3|."i'}{CJ El Ckiltll _ _ El U:I)['F]{D} 1:! cum _ __ EI Iih}{’?1I¢u_rn3-5 =.1f&iJabic_. am:-uusr E-mt Ear review er the mic gal. -_- -- 1-: H M nae»: mcogde. ahcuuld b-2 aulmmed. cum a.=_-um: iaclu . ' ' name L: |. E in. tea ' ' ' E‘-‘ .1‘ E Gus: Jain: and n-{ecu ifhirfll. '. _ ,_ |I_%|fVic3. branch and ru3:I:'t-su:.- sewing _n.ucnbar. name pfa-zrvic-e or <=_mp|o_-rmnqt, mpaxtmhb 99I;piO:r.i|2g I:-d.I1_rJ&us|.. ~59-I?I:i.{'Ln3 ¢2.-F‘ ~_ $3,. _ .= . _ _ _’?rnt"-infer-|‘a'1a l.','11'.B.I'ldJ'|3-rEf|£rI:I'Ijc,.'r I§g¢F:E‘§é . o«_=_ ,_ - _ ' ; " -1°.”-idmfi _ the ' cs#1a 2..é1mJt'eL1o[.é. __ l _ _m :1! tr { ' _ _ . — -_ him mu -«.15: msamjufiz gf.§:?&:a??’3:fi‘:g;'§::“.:;{:5S,?* m:=::J*- ~- Eflagggglm Egfivymfigrlmigittgflfiuficcl. In:-ru:_h and rui1’i?.ar,r ggt'vLu;g |i1.|In|:Igl'_' ya‘ fig -_-‘uh flDQB\IP|“3:5!.§acU:lt'|:yoL:;:'I.JI|:':“._I;]g-l',E:t‘ IV) t"f'.'r|fl.\'.' s§u:lfi-eigllflll I!) l I1. -"s=:'a'15e<:1a'l' u-cfu.-sh ll: .» _. . _ V *3: .-_.‘_ I W917? J."-"91-awhei ks . - . .*e..'_az»_2amaa;m-a - . bifffi-EE? ============================================= ./texts/FBIZodiac6/22.txt ======= Dap..n.DHnEfi:'_ Desi.-ELD--5J1-2'-—.n. ============================================= ./texts/FBIZodiac6/23.txt ======= ============================================= ./texts/FBIZodiac6/24.txt ======= OFW|B.|IAL rum-u Mn. nu ' ' .IuLv In-rs nun-an ' - ‘a. IFFA. rm-tn an -:rgI n; - LJNLTED sT.d.TEé*’Gc-wifi{RN?~IEN‘T .. Mémorandum DIREGTDR, Par -:9—a9911) mm gnans T” ANN; IDENTIFICATION DIVISION “'3” 5- , LCI5 ANGELES (=52\—i§E§5-1) 5:; _ _ "““”“J“" LEUDIAG EKTORTION DD: SACEAHENTB —..p_\-_- Re Lus Angeles leétei to Idéntifiehtidu Diviaiom _ hf23f?5. and'EdentificatiUn Division report dated 5f12j?5_ > Enclfiaed far tha—Iflantification Division if one print card bearin l:hE- mm- prints and d impzeséicns -4qL:_W"af FBI E0. M9 ' The Identifiicatinn Division, Latent Fingerprint Q Section is redueated to compare the enclosed palm prints p;'““” 0 1th the uknfiwn gxinta in instant matter, I T_ 1 nt case number Ap1flfl42_ h _ . W tr’- Results of the examination should be furnighed to L05 flngeles and Sacramento. r gggafiszfifi ‘EEG-11$ I.-I .-‘_;£;3‘ (:)— Bureau (Enc1f3i} — Sacramento 2 w Las Angeles 3 Q 4 ‘~33. ‘Q -3} ‘M. . *--. -3-.. ‘Q 3*} U--5'- -5_°“"=;'?.E-T B0’?-‘if Rrgufsr-fir -we 1:5‘: P-:51-ml! .5'.H-E:I;g.-r i’.?.::: .__..j....-...-..,..-..._,,_,,._:.,._. l. ============================================= ./texts/FBIZodiac6/25.txt ======= _ . M at nm: fiuypu '-.~::a'§11i_:=;§'L'-"gm. n_I‘1:,-"En. T. ‘- anapoggg ============================================= ./texts/FBIZodiac6/26.txt ======= ;-as in-.~r. IL-s-s-3: ' .7 -L - -L‘-‘-'*§? .5 I . .<' » FEDERAL EIUBE.-EL! DF INVESTIGATION =‘ L}~TEN1" 1-n-It;En9=a=:LaeT slzcmm wonx SHEET _ Rtmozdsdz a,!25,«'?5 3+. 25p_.m. gag Raiefflflcg 14¢; 9- 2295 E31-swer T0: SAG. Sari Framziseo 5' - 1-"J3IF'iJ.e» No: 9249911 - ' He-:91-red: S!25!'?5 - Lcrtszlt Case No: #10042 ' EXEI ruincltiou r-equeated by: A-dares see 61 6 ‘if- G-:-p:r tn: Sacramento :9. Q ‘I; «BE: z&1i:;-ac ' .=. _ .. BHIORTICIN -Darts: of reierenc-2 tummuniouticlrl: Teletype fl,I"l9,.'i75 _ -%g_ig1£us: _ :=*-rn?-Tm E:-~' .~.e£~:~.~. io'7r"' Fleaull; of exumincsiion: Exumimptiun i:_ ' pmfi Li %rfiLLu'Cyf¥ Ewdeu-:9 noted‘ H - a - Jase-gm W wwmwbwffiufi an - Lw:.:./’ cg-3e{...:..—-' Eitfiihlnutihn cclrnuleted . .. -01 Dlctuted g '6; irna Date Date 5” ,.-' -' ============================================= ./texts/FBIZodiac6/27.txt ======= -35$. -"1'mi~i Luz."- ’I"u1<::>§u:aa'I.-y- ‘Rug. .\ °D_§w:t9§'a S_Et'.’3'_...; ============================================= ./texts/FBIZodiac6/28.txt ======= L_.;,.%£:;h;__nua:AJuL%J an »=.'e;s1a'n'zL'u.a, I}? 1:. ll:-€135 |i_-.'. T- LE-T3? ============================================= ./texts/FBIZodiac6/29.txt ======= I,.as [Flc-r. I 2-5-93] __ ...‘_ ' -_ ___. E I-..»--'' .5“. —. " FEQEHRL E-LIHEJKU UP INVEETIGATHJN LATENT FENGEHPFHNT EECTIDN WORK 5!‘-[EET F|.B¢<:mded.= 9,325 .I"?5 3: ].5fi.m . 1:-(lg Hsefetence No: 52-5554, FE.IF§J.e No: 9-49-3-11~—. Received: ‘3‘.u"21'+,'r?5 ' Latent Buss Nu: ,g—1fl(}.:;.2 Answer to: SAC, La,$_fi,1'1ge1€$ " -- - _ _ __ _ Examination mqussted bar: Addreasee .'.1£e:"§ Eourto: acramento HE zctzflat ' — - E}C'I'DR'1‘E-E!-N __Du%e ui zefemnce communication: ]_,e1_-_1_-_e3_— 9f1gf}T5 - --—‘%a:ac'ms;=s= Lifcsiant -' FE-_].l'|1 tints 3414 i e '.r:l.111: impressions sub inter! of sus-pent: ' FE L1“ 1 I r~ (‘P uigfiyfiniff a;.:«..:5 ‘=~:-<_..- U1‘"‘§%\§& M W aw W Wéa» w/ %3».r?x=:a{;AwM»#- r.«.-~v~ w+:- wjmww. Gaaovfi, Ev \ _ 3,91»? r-.u:.¢:vviU [*‘w?'::»~».x,mi.—.»L1¢»« <~f;"-zJ..4.~4u»—~r., 4/ia~~.e<»»«L'1-~Jw+/ % Exu=_1EncItion comalstaad ' 5' I ljqjéflja J FR Djcigtefi J '3' -3 ’ T D-at-5~0§Ld___ M £508 Date ============================================= ./texts/FBIZodiac6/30.txt ======= Pp-:35 (Rev . 3-I-I-‘T-1] "DIéECTGR; FBI [B—49911}"'c' EAETN: . 'ing;*:':_;p:ifits of zodiac do1'rcmu.t_1ir.:at:.pn5 a IDENTIEIcapIom DIVISIDNJ5 ============================================= ./texts/FBIZodiac6/31.txt ======= _ .»z’i=_rri:‘~=*~.rfi“”fiv_ ,3 'f::L_1:'._".t':«_'.L=:E'=IJI:‘--rr.- “T"“’ .. "5,“”-°3°§_'E°'_'1J We ,1, ,&/,e4- .s=s.y/J we ¢.—,~,.;.=~ _' ‘W’? 95"}-'-“A .n-55,4? .1;EI5'P/' ' - -bu-n-—-I //_, :30} _..::I9,cL.€3.3lJ$fl I -.-.w-,_'4}_~.;'-_-' Elm-2: D-'rfi?S Enfiltin-n.: Author: Ed|.h'W'. Tlll-2‘. RUBIN: 5‘--53 Uh-:I|'."£|>¢|:&ft or e;o:=::,|Elr:a1Lag|: -Eubnllltlng o£u=== 3'3 1:] Qqlrl 5 in-ag::I_q.::9-g —..—....-.........¢,.-_...._,__ ============================================= ./texts/FBIZodiac6/39.txt ======= °'-“""’ —Fi'IhtiI Page I a Mac: at 11]:-adstabmd blue and white n:]uti:i,- "'1'hii iii the 1'-sbcliar speaking. I am U19 !|'|'iL|IdE;'ef Iii the taxi l'.'ir'n-'81’ .._I-§I.sti:i,igi:||;,ti:I1:i.ri>1.Ie:1;Li5 tsmisa - hluokiainefi-p§e%:qE his shits. _ "I am that same man '-=ri3=‘e- did in flu: [Jei}]:i|E: in the North Bag.’ eazea. The SF P55B- T132 ca: flrhners should have 1|-1; tiaeir cars ta-id sis: there I quiet ‘Waiting for me to come out _ That ml via Detuiictive Tus- chi's first night on the am of "'Z3dia':.'EsJd'1a3rs'c|im.=;t brush with tale 1:i.I.l¢r. Eight yam later. in: still, 15 Vi‘-1J.E.irig'f<)rZod'Lae 19 com; £r1,|_i:i:|E _ ecu.-er. |t's E! ]|J.|2|EJ5" wait. and arm mate ‘i 111‘ I Ziiiiiilc liming or communica- i'ai)iIt rubs his I]"1.|S5.J"£3lil3.|1. Today '5 the imirth anniversary DI Zodiac's last dimrt tximmunication. a letter Tflschi EEIJ't'sit$ at all times to 1-jrizipd ltimssli that he has failed to eaten IIEIE i'-‘If the must jiobcifluus ami IiJii5tEi'iDii.'a -:r'u:rI.1'.neil.5 in history. ‘'I 'i:l'I.1.'i1k Blue is ali1rI=__" the dETEEf'='?¢ Said in 811 iuuewiew. “It‘s almost a s,:u.1 feeling. Hut, u me had basin killed in a.L-. accident or ' K-‘0DJ.131ii-‘I211 SI-Io'.i‘3:i.d.5 ur been mill‘- dfled. 1 baiieve scrumune wi:iuJfl have gone i.11tU his, room, And : fliixlk ll-E Ewltl lerwe son1eti1j_13gEtir - 11.5 to find." It wnizid seem uniziaamctcristic for an egotistical !i:ts." none '-Yi.U1 fii1gerprL13L-5 i3ia.tI::i;iug thus! tutinil at Zodiax: murder aoeruav. - - As. the resuit UF wiadrs Brvlm ' Sti>1’.iEE. H515 ha.‘-'3 130813 5.11. it‘EI|C|'l 3-U over the world. mtiuaing Canada. fiumye, New Zealaud and Austral- ia Tie aranim have to be 'i:'iv'%Ed-‘Ed gut Erna: ;I9i.Er.‘I;i.$ win: beiiete their know Eqdl,-at zlfid L1’; 3 |!|,R'|.I2~’.‘fil'i.- sL:r-cling task H-s has had in uunteizd -mri .3 5éif\3§]§IL'ILF=iE|‘I heipiast :e.i:n:: sailed‘ hifflfesali ‘The Valiant (.'rusaci9r." all salt:-:2:-'.IIi-:: named “{.i|d Tom‘ '§'rr|3i2I -::|a.'i.i:nzd to he Zodiac sud §iii-_;_od_ ‘-\-"fl¥'|;‘Ii§.I'!- ‘«"i'i:iI‘.'I triad ti} finger thSi.r in-rmer spoia.i=e.i= vr i2Ii?'_'i'1'|.'i_eDd$ out as renrgnge. _ , ' Tips t?fll1.ti2'l1.1E to your in at a_ Tit-E OF §‘0LJgi1§f one every ii;-rag iiays. anii 'FD@.°.tii runs l§D'iin3 each '1.=.ri=i3 Salifififxl ttiaiixnnniil not [em in 1lIIB.lUU.g-5l‘Ji7_"ElE igiilw. - "I have no idm 1.Ji'|:iai:'-.‘.ii:Idia.r: iwkfi like nuwi” he 5ai|:1."]'3u:’s the problem.” Ih"%'!i-'tl:rJe.ss desciigitiorgs of 24}. iiiac C311 W ¢|3'D5i'd‘3l'|:fl_ shaéiy -5: ~- bs‘-st, esp:-2i9.|l.r siizuoe ei,i_=J:: :-ears have passed since me but knu-4.-u Sigtiiisig. The witnesses at fly: a!.a:r- lzig iii"«:3.b driver S1111-2 re [rL2ht~ sued. The police air er: who saw; _ Z-cidinr got only :1 rl mg 'h'iq13'_ _a.n_if "J ' the anti‘ time Z-C-'l‘iji’E![I.1l|3', ii:-Bl: day D131? come,” the aemetlve sami...-_...,_, '- - . -- - "' ============================================= ./texts/FBIZodiac6/42.txt ======= 4 I13his3i'3‘fi:Ll'5a5ahan|i=rrit- - hamelt he can has frustrated .-IL-nod Hurriil as much 3a51.hE iax: k.iEleI.' whose hraarrg and that II.l1te:s at-2 b2]i3'_°r-3:1 in he _ . .. . ¢_____‘ _ key In his identity. tr-1 like tl? tied h._1'.m befm-L-I E," the $3-year-use ,'l'!|l:u:J:iJi said. i‘ he dies. E wish 2Le't:i lean’! a me saying who he wast" S.i.1u:E: 2'-ac1jac’3 calcuissasefl tar- age in the 1613 1960:, B‘I0uT]1|,h3.E. triad more tin-ti 9,000 wfitihg nrrples 1‘uL;;']a,l-'_l'_ E.|'|.,El'.‘I?|2lg:n.B:|'|.I: .:’E'a::';aJs an ZgE].ia¢‘s'f“ra:l. .. ' --He ihwu't'é"7.udiac3 dist'rr:c—' ; - pl-i.n'r.i.ng better than amrune _ - <5-sI.r1.]1. E'a‘_£d'L wclfi enough to '. u iton a bank 139']!-Cviiit mp. ‘And he Dali}:-res. as does S-211 aacis-so iiflmitilie Dctscme -re ‘ihachi. that if-rrilI's miml. “His printing is I:1.Eittl'l-ctive.” he said. We i: an mtgiugent guy amri we lthovr he (in-lib-p-ril.lvai)' 111.1331:-etls mm? were: becémse he suntetirmsspells them cone;-113;. “His punctuation and para- grapizing are perfect, Hts tense: and q5'1‘:Laz are perieet. E-l§.‘. ve- :ta.i:v1:ier:-' is gaud. _ The ileum’ K is particularly mflstariding. it's made in IIIEEE aiizlinct strokes tamer than the time] l:I_.l.-a." 5t'Lli.. Zofliat was tarsiul when he Wrsxte the !3]|:Il)d.,j-' detajlfi at his kiJ|.i.rI.g5, tlrurnzaselucl in an-eel: a actual bus and :Li.a- gramecl 3. home that ex;-eras say would have detnnat-er:l, i'Exhe§i'i iiaieimiaediifl " 'ham+iwiiiihg’e iigi . ii i@r*Eefii1e:c-- ;;ia:t; T.TsLn§ :! hali point pen he - wrote an vaxiuus t:.I';:es at paper. but It g¢I|'B!B.H:|-' was cheap, |'.1.'i:l:l2- sturz paper without -water maria _ that cmud tn: traced to _a n:umu~ fectttrljr. And he never Jafl any fi.ngerm-int; an the paper or ers?dopES— His une departure tmcru-this Emmet was after 11231966 murder of & Iiitrhnilie med — a murajmt fillthflfities behave Z:-t-tier: sl:-‘u;-,hL fijfiunqr - n...l.dl-:I.\.'q,;,n¢¢.,.,..,...,.;_._.,, ,, . -. _~—v*"-. ":5-' - . :-; SHEHWOC-an uoeeru. manirgn mree zonzec use ‘I'd like to find him bveftlial die.’ _the handwriting enpen 52 to enaceai fer some 1335913. ihefiivanideareaaiacinimi Theugh itltna then were nut. ml;-J1 smidned 11-9.a:1'i:'z'-'r::.5i signed ‘°°ZacI.is.c.-'* irlunill I§n;~tct- L11, the Vallejo ere-.1.\~'%I¢l:eaE mine-.i than typewritten letters on lciilhxgs ocean-z-ad. ‘gum? 73?” wm f'°“1 ‘he “The nine 1:-lg fault in; en‘ fluwgh ehpiilzaiiorks for ac ]m.'e$Ligah:Ir5 were 'I.Lrla'bJe U: is ‘.ha.t some are typed and bass aim paves: to LI33 military heal a sig:-iatum.” hlorril! i:ltS13l'l3I'§511$ that use ireletgrp-2-s_. pleinsd. '"5I2l'1'pt wrili yet 11335:: were shut: Endjtatil:-J,t5 prmlimg 3:2 vl‘i.i:'E¢rl3:|3t.." the killer waeaaeomated with Lin: military. F'tJI;vl‘pri:IIt5 at two cf the murder scezruas appeareuct to have -,i:Iee:1 made by suiiitanr-type shoes. and wins witneases said the kJ1|er were pleated military- targte pants or a n1.iiiI>a:y—1}':Je windhneaker ialclaet. . The ¢a.I-@113 lciiiing and aha p-ufiihle m.1'l.ita.r,l-' chuzl-2ct'i.0i'I. sent Irlcurrilt -- who has handwriting 'Lile1'lti.fi1:.a!1'oI3 - izl.-mil.-'1:I1.g black: activist A: Davh, E6335 l:J'.|§e'r Juan C1: and the labs hiilionajse 3-I-:r Hugl-L-ss —5eil1 112 would had trouble positively iwt-zntifrin; 151:: in ¢<)‘I.rI.'t II it came tv :lr, "1-ianclw-=ritLel_s is as dis tive as i'i.I1.geL'priJI.t.5," he Mwfin on the arduous 5351: 121' - TM“ mandwfifiqgjcintumg chmkmg hfimiwifina “M9565 qi as alimnssiitle IJ'.l I:cuurL.. th.*:Iu5B.'l1lE (Ii college students in Tin; fir-_-[mu 5 _ . ============================================= ./texts/FBIZodiac6/43.txt ======= ¢:4K.oFR++aL$3+ N . _ ,3, 3 E: __n.=.H...n . _., usu¢Rmmw%%mmBJ+_ae9cEmL .. . If I . _,,._TnB+P}.._+.HFT..__.._m._.w_&awB.¢._Kw. _ ;,T_....:.,+_5;_.,:.;....,_v.u_mf,_._n..m._ Wé.§OP§5?34?HH3V_J 9Lm .m..:y.m.._.rcxuaqBor_. ._,asm..,...a$ _,._.pne..v_--mu+a+no..mco<_..H+mm ._vnz.n.u_aaRJIEM$dLm.c...._:_. .%.m. . 5 I. .«_fi..0u.._A_LDIHzAEI..+_E_@.Kn9W...du.nW%. .Jn+J¢Jat++¢Im?IBa&<9m® M. as n1¢..HaHc@.F.D._a.EV9n.....u\._.nH..fi.LCWN%W_um _ ._R+3_u.HR+$HJnnD.aFvn.TGun.unDm% ..mEfl.Yfl.fl._£,E.au<:G.+..xBEB_J__J..1T_.f mm. ._HNB3D......E.mIG_ ue.®..Jv. R. M...m..m_ . ..T|.b..%..w ============================================= ./texts/FBIZodiac6/44.txt ======= _x" _ &?'a_cs1.UngE1ar3'?,-'[)'_':t;_:2ge;-?f:-':-'- _. , _ I - .|{EPORT.'_ g =_ an _ _ o|'§E1c_ _' __ : -_ _II_1£_1_urIHc_'AIItJ__H= nwI_s_Ifl_H A "E.r'¢T 1=Ire'r3_.E:tE'.J‘%_:raT-I.s 1: BI.|R_EA.U or |Nvr**11_g;L»_ ,. :-«T ' ' ma; 42*» .- it . 7 TI -.' EEFDRT {F3 P‘I 'I*.?*s'-I:-‘IrF..rJ FOR OFFICIAL. Ira-E -awn’ 1:1._,=...'¢-Ffigu Eu; '1'E.'.I..E"I'YPE'lJ}l'}'I' |:,I . _. --I.-=__ _' ============================================= ./texts/FBIZodiac6/45.txt ======= I /I"-B435 I __ if J‘ E’; -' ‘ __ " , ‘ 7_,r . - FEDERAL EILEHEALI -3-F‘ IIWESTIGATION 1_..a.1-5 NT rm-:;£; HPRINT SECTION WORK SHEET EH owed: 5 3 :35 [J - a'|'l- '3]-P‘ Fléfere no; No: 9'58 {P3 . ' FE: File No: '9|_3'_|.'~';‘|§I]_1_'Q(§ Received: 2,51},/‘E23 - Latent Close No: _fl._;I_0fl1|-3 Answer to; 3.19:3, S,§1U'RPt1'IENT[}"- :1." ' Eamroétmtion to-:gue$t-rd by: 3-IJDH ESSEE Copr to: " "I-‘I15: m§::o‘i:ii't:.tE _ . I _ Ezcrof-.':IoN, POLICE n::oo2ER.a.TIo1r ‘Doha: ocf Iefereooo communication: - EIRTEL 2,/"]2"',73 N.3.I3;En-d Sus e . _ V3 *5’ FBI ‘ , ma» Result of examination‘ Eatoroinotion by: ‘ I/__ (“W §_/‘:7 El.-"u1E:U:e noted hf: ’i‘;"55" ’“‘fi ‘W M"éé 9/2 I afgcs samb- wwggiég (Mam at- )fl-‘'9H---t''*/ } _ W '54o:W.Mf¢.w./51;. 4*/M 9% Q7 }"'?ffi,,;g=\. -C.¢~»:'—r-= K,“/é '£'”'MJ"‘é/’?“{ E"H7"d Examination completed -'9 . 1__,Ej Dilztclteii "' ;é'F IrI'-Io; Time ate [9 .. _.:- ---~ ... --___'-_.fi-'._-_--.---1-.-, -;..- __ .4- r_-.-_ -. _ .--_-- --_-5.--.-.5‘ -: ============================================= ./texts/FBIZodiac6/46.txt ======= .' I 511 ‘ii-_L flaw with aamarrszufi. E‘-3i“‘”"'--' . um =r19?3 _ ri |31T‘r“ AND |:.'E|J_lN'|'Y EH-‘ SAN FRANIZTSCEI “ALI. or -M.|F'|'||'.'E FIJLICE pas-.-mm -am ' um nalvnprr gm“: 5-4-I‘-I =|UtN'C|SDE|. CA.LI|'\CIF!NI.-H. |_=|d.|CI.3 3/? ii? :IrrI:: aiixuc CHIEF |'_-,"I-' :=|1|LI{.T.E .-v:I:u-.:a:- .~<.n. -:-urnnun:-:.n-u-:w;: CH3-'43 LE5 5'. |I4~‘~|N cm: or g-cn_n.:= J H9J"'_]-59 1973 ! 'y;5['..B1: & smite |N' F§.EF'L'r'; F'|_EI°uEE F:%FER TC-I Tafillieun E. Habatar. I!'i.r;a¢'h<:r F\ada::§gJ._ lhmm; of mvantigatim ' ' Pe:nna:r1"vw1ia.'.§ma:a1e at 5Ith stunt‘ "-- 3-03%. "$hi'lJ.§§0fl1g limb 5411/ atmu»=§ . In 3 3' Qlesfiiunad Ivommaamtes —5aution In I.I==. FILE: IE'15.‘!'fl"3-1;.-I-_ Eéb Sfl5I3[}57"~D .I' 9%: 9 ya ;_,__._Six: r _," 1' ,._ Requ-asai: an analysis of the amlnaaeni " lattam tu- flfliififllihfl ‘ma n'll.'|l1'bfir of EEEDIB. ED iflfinfified mmpact at 1'-hifl file. Elsie letters have been ezaminafl ‘DI Hr. Sherpa-ad lbra.-13.1, Galifamia ]Jepa:|.-*Iaent- of Justina, 3:111‘-_-an or E:n',n.f.n.a,J. Iiantificabiun flfihnationad Document-B Beotinu] and Mr. John . Dinah: uf Grins Iabozr.-atoaap Haatara Bagigmal Office, San Bruno, I-'«a.1i.fe:md.a. Prior to his rat-i1:'aman1: in 1973- Dir. Eb:-rill d and aazfll-anticatefl all of the "main" letters, j.n::1ua_1'.ng.- the ma fliamteé B:i1'\a1Bifla, Galifomia lvatt-ans. On May 11, 1915 Mr. Shine alanine-1, for 1113 first time, fiaeaa Riverside, Calif|:u:|:Li..a. lettexa and famed tha opinion flclat they were not a'.u.t.‘h,o:ed. tgr "zp:i.i.axs'.. we are mrguaoating this additional aznaaninatinn ta aathla ‘flu diaputéfl mflmnmhip 31.19 to the aanmmesa of 32:5 case. _,..--.n._ "2-u-:'.iax:"'.,:LsI 9. mass mazdarar to uhnn Ha hays attributed six l:u.r.'nIn victim made 1966. and has £ruhaequ.ant2|.:r :°aagp1:ae._"efl by aanfiiug a.notha1: latter tn .3 1n-oa.1 naiupaper. 3- B?“ 1* E- t I .==c.-mmea an-. muse: aermchi. Gnlitomia 1'-6.139 Daparuant: ur Juéutiua. Rlraan bi‘ criminal Investi- satiun fiqmatianaa Document Sastim} and 1-Ir. mm Shiflasln, Dire-ctarr or Paatal On‘.-a Lahuratcnrar, ‘uilfistam Regional Dffina. amui explained the nature of this z.-aquaatafi. examination. Eeithmr J.II.Ii:L1r:'.fl:I:I.al eflrrxuaaarl my reason ihr the exalinatiun lh|:n3.L|i. not be uon.&u.ntIad.. ;.g;% 9. 4:=zr-:«x«%r;:'?§-“ U Mar 241%” ‘giieg ============================================= ./texts/FBIZodiac6/47.txt ======= William E. ‘debate Pinata! _ _ \ Fe-ieral IBu.nean ’-9 wafi-5-tin-n . North. Haahjngt-an, .c. 23535 * $1 1-6, 1315 ' raw 2 - 14. j_n:romg,tinn_ can be u 'hu'_nafi. c 5 Inap-agtar min 3 In-apech‘-‘Ii:-‘ Q '5 San Franaieeu as p t". Huniciie 9 L,’ 233:: S-raw.-as-r., Raul hfih, Stan Fransieao, Ihlifomia 91:193. - " Telephone (1415; 553-11145. Rafa: Eolicida Gasser -§E—9G3111 I3-adimi Doiafbar 11, 19 5‘. _1_ V Sinngtuly. -: - "" - E. —\_.. C‘-EIEF Eli‘ POLICE I T ... .- . ‘.521. __;:-_:._L._ -Ewptaiu fl:1ar1aa.1.-Bomlexir - '3'l:auhna.ing D££‘ica:' --'-— Penaunl Grimes Division Ennl. 16 1at—ta:|:B luvmxiory attached ============================================= ./texts/FBIZodiac6/48.txt ======= '-.- (-aan . - "- Egflflmf Oi? “EH.-" EBIDEEIE ' f 1. 5". ‘:5. H115 paga lafhar and anwalnpa puaanamaa 13 uni-aha: 1969. Claim: xusponaibility for mflar of cab driver. Fianna oi 'via‘|:LIn'a shirt name 1-Aiih 1&1‘-'1’-952.. flit 1:355 latter and eIcr1v91.a;-he pastuszked 9 Iflmmmber 1969. Claims BE-YEI1 1I'i::ti.1Ia.. Eiseéa of 1I:i._u‘I:.,f.p"a ship‘; can; uiih latter.‘ _ , fine exacting and and eam.1-.-pa peéufiaiiéaa é'Ha§mbe.2 3.969. Higher (same with cmzli. Chm page letter in Fe-1v:i.n Elli wad. 4a:rJ.IraJ.-Ups PQB 20 Beauty: 1969. Piano; of "1"1.I!‘h.i'.I.’.B shirt tame wS.'H'.1. letter. M: p°3§la"iat=:ar and narnwarlrapo paatlnaclflcecl an 1px11_,1953. - - ' ' flan?-Ii-1:!-9-r1 ciphaar, bomb diagram amt th1\ant_a@inn1 manna] ‘:33.- Gfl-B srevelhihz éarti and envelope poaharbed 23 19?: ' buttons. _ _ I1-1-El plan 161%?-Br. nap and mini-:-pa p-astuarfksi 26 Jams 1310.. - lhnc-1'-:'I.ng Inn in parkofi. ¢.a.r.. 12. 13. " '-1.1:. $3 pugs latter and anirnlrspa 3:-natlnanzlsrgd, 21; July 1370. Elaine 1‘.In.m:.ng 3.. wamin gag, Fire page latte: and uvulupa poataaxkaa. 2-5 July 1970. 'Ta1'fiI.re his flaws, has lint af1r.i.ut:i.=na. _ finllalnml uand to-and envelope postmarked 27 Dctober 157:3. Parafliaa Slaves. PM-1:-:~ cow 9: in-t.-ha: and. amwanlopa poi-hnflneul 13 Hun}: 1511.. In-ltfl!-E Dent 1311 Int. E5-in-at - original: in pun-euaiam. of I-93 hank: Policy Jlapnrhant. rm.-a mmlope paratuazked. lh Pe'b:n:.a.r;g' 19']fi;.. "ELL" "':B1dJ.muin" ncnria. 'IP|o.¢'l=oI:'d.pol%.I&n-d.6!I|a*19'ff-h . ~ . Dan pig litter and. nralapa porhu.:|:e-E. E Jul: 19114. "lied Hs.a'.I1t¢m"' film Nu latter and. envelope pozhaflnaa 29 Jamar: 19'iL1a. “ha Emnist’ ' ============================================= ./texts/FBIZodiac6/49.txt ======= ; an Ii " :3“ 1.35% mtmsm: §aan1ir5nad?_wa‘°' 15. 16. ..nts_;ad._in an -umaaai bnaacnmt. (hie page latter B1141 &Il.'|'."e1cIpq puzmafiked 214 Aglxdl 19'i'5. "I'm back vii-J1 pm-+ Photo aop.i.aa_n_£‘ -thmae lejiiara and any-alopaa poatnaackad 3I.'.I Lpril Plush map: of massage‘: written an-wad fiflflk ‘I761-'| Hifli ball 196?, point pen. Erma 0:55.531: in p-uaaaasicm -or Hi1-31:31:19,, Califnmim £u.'Li¢:a De-pazinant. Eu: three letters were nail-ad appmzinaaalgr six monrtha after the killing to -Hm lo-anal mwnpapar, IE1-unezaiae Pauline Department and fine 1-5.ati:‘n fafiwr. 931:: manage 1111 um dank trap was _d.£nc:,-rvarad. a‘:-out the nails tile. 5313 desk. had been -_._ __‘ .;.".'¢A_:__-_ _ . ============================================= ./texts/FBIZodiac6/50.txt ======= grsvriiinfmmrrmb : -f '-.-Le. .. _ __ fl :'._‘%‘$‘e»r.—~:»+:e_i=n?.e:5. ' ' .1%::.?i5 ?§;iE1°‘e aizztie-1* tp - " " =; ”. - . . .4. . >-. e:- E9? " ' am’: ' ‘i’-3‘ fi_m=.,,,.. , " -3-.fi?"£ag"_-.__ ;1_':E’t'a r _? ============================================= ./texts/FBIZodiac6/51.txt ======= ============================================= ./texts/FBIZodiac6/52.txt ======= ============================================= ./texts/FBIZodiac6/53.txt ======= ============================================= ./texts/FBIZodiac6/54.txt ======= ============================================= ./texts/FBIZodiac6/55.txt ======= ?-W +F=%”- H‘?-W EPECI.-kl PHDTBGRAFHIE UNIT 1510 mam: amass! Ref;-acct b) H _ '.6=:L_ R291. TT P'}c'|«Js.?-asatrcr _ Law '«"j Da-=.—, Jiocd. _=5_7.3_,!'' " K33 W» -1* "‘ I--' ' _ _ __ D;wins j } - 38% by ' RE IJIU EST LATENT PE’; Ya; |:! No- 'Il'CIRK i‘ ER FIJJIME I1 .. _.r -- -.-. , 3 Repair _ 5‘: Nays. E P-'-JIM #9? Hour: "learn-s End, to - dcm: - D=IU3' D:u1I.:Il3L_a{l ]U.§|2ia1§_ - _ . ,_._7 . :x/''- _-I' . N¢. finds f. I t5 Elwlcrenl ============================================= ./texts/FBIZodiac6/56.txt ======= _ 7-3 ' ' ' - r"‘... . ‘- /1’ E ' gr.-=. . - --- 5 : “_ ' " 1‘ -o_ . ' I ‘H-9 '"-“as. T we ‘a_ FEDERAL BUREAU OF‘ IN‘s'ESTIGa5.TIDN gfgfiffin umrzn swrres DEPARTMENT or» JUSTICE JC-31 I._ahun1|nI'_r ‘N-u'rk 59-cl" nu Mr, Charles R. Gain i JV Chief of E‘£:-I|.':I'.v:'.e-_ ~ ' _ _ _ I__ _ _ 9 Hall of Justice . __,..-r '|»}'- , 353 Epyant Strget FBI FELELNG. $I—il‘:'IE|1.1 _ -7 San Francisco, California Shell]? - Lee.Nm 8051906? D LL ‘W15 Attention: Captain Ilhorlee A. Eehuletv -eosifioiofii l—L— 3* Commanding CIffice:r~__ _ mun Ho. IH-l5fi$—ll1l- U'_'M'L_;_;Pm-1‘, leg gc;nE3¢£:1I‘I‘1:S+L1:f'£l$[leAOn ___u - __ ZG-DIAHC . _E}x$uu.izI:=vT.i.on tn.»- |‘:-ic.>1-r1_;u_..j <._.- E1.’.';l-.:I1'1l"-.-:>-—-" -I - ,,. rr - » Em.nn_mu H-W Hi? __ Iran) tn-.14 9- W 5:5?-C }";:?e1 E3.-1.-’I£L'} £53) £M_:___J —mW;W ============================================= ./texts/FBIZodiac6/57.txt ======= ,_.—- ' Q91 One page letter and envelope postmarked Eh July l2?D {Your Item #?] Q92 Five page letter and envelope postmarkefi 25 July 1330 {Youfi Itea #33 Q53 I940 Halloween card tc> n-:11 envelope postmarked 2? October 1970 { our em } _. 1 Q54 Photo3§¥§1of letter end Envelope poetmarkefi 13 Hareh F, 13Tl! sent to L.A. Times [Your Item #J__C|j - Q95.” "ii - _Card and enveloye postmarked 1k ?ebfiuary EQTH {YDur Item $113 Qflfi Postcard puetmarkeé 6 May 19TH (Your Item $12} , Q5? H fine page'1etter and envelope postmarked 8 July EISTH [four Item #13] -1 :fi§F““ One page letter and envelope postmarked 29 January '-w~ Le?u (Eon: Item #1u} Q99 Ghe Page letter and envelope postmarked EU April l9?E {Your Item #15} ' ' he Qclflfl Phetoéggihe of three letters and envelogee goetmarked 30 Rpril 138? and photocopy of message written an wood desk top with ball point pen.(!oup Item #15) (‘Ev-eI».42 £1“ .5 1.511 efifi.-‘_) Page 2 Bflfilflflfi? D LL ============================================= ./texts/FBIZodiac6/58.txt ======= ============================================= ./texts/FBIZodiac6/59.txt ======= ,.l,_3 -. . --_ _ _- .- i _ -\_....°" '2-v’ ' 112:-3031::-an FEDERAL BUREMF OF INVESTIGMIUN 5 I 2%’? B UNITED S"J‘&'l'ES nE.PaaRTis1B.NT OF JUSTICE ksl L-uhurutory Hark Shgr-1' Tu:5flC, San fr-asuzis-1.1-:2: "<9-22393) gm E-“lLE::I‘0. 9-I-+5311--"‘Z;Q 5] L.-a5.m. 30519013 D LL EODIAC Re: EXTDRTICII-I , __ _ ‘mu-5 mo. F-SI !;I_C_.‘E '1'.‘-G'CIE'E RA’I'II2I;'vl' O0 : Sacramento ' " - - ' _ Emmiuamsc II}: b"7" E§zarn1a:*.ianI9n1'=eebed1J3‘= $an Franciscu ‘°’_:fiz;r.-a;m= A’-ital dated Hay 15, 1593 Exssujrlafion neuueated: Doc L1.I.ru_=,n‘t Evctimna reueéwfir May 18 , 1.9 '5' 3 /(ho-cofi$:3 of {mg ‘$4 g.a3.);5;?5;t._{7 j) ,a;.a’.» .--"' Fla-I.r |:-0.! +‘*"' _ — — v.rv-mono-_9.-go-we ============================================= ./texts/FBIZodiac6/60.txt ======= -.I_L“- ,,_,.m,,,.......-..-...-...n.w..n---- §¢.|n'.IoJ “-3- - . fig ' * 1 Lnananrnmr $9’ hinglon, n. I:, Date T Time /5: __?_é__ if S‘-'J.'DE .u CI-I éCKi‘1'G'9'1'LEDGE-'!| EINT of the . __ _ T EH93! ma: urrifirnurl ' ' ‘E ‘?"T.|<..I 35!? C3‘ 55 43”” 13%,} ; ‘ ‘ ' ’ ‘ ‘ ‘W TWLEL-?.a-saiecl hoxig§_J', it-§_g&-3 ufevidanes fr: 1' Eatanlinaliuzl in connection with 1:353 number _ .?%._éfenI:itIc>s er datré 15'1" ::~ar.u:a'LI:I HI. buying conducted. Following to cu!’ tlte se::amjnatiu11$ and filer; dis eficuatofly of the FBI Labgalury while the :3: mplstiun of the examinatio- aruinations are sH3$i.li.un 9f the as. a apart containing the as-.-a_uJ[-,5 i.-iii be forwarded ta}-our dxepsrea-nerii. wfi W Dihaetor Eederaé BLI3:-3.au of Imrestigalion _ 5 AT n I ============================================= ./texts/FBIZodiac6/61.txt ======= . .. ..:....._s...... .. ......>3..3._._.5¢>.§89.5...= . .....:._...... ============================================= ./texts/FBIZodiac6/62.txt ======= mm__§_...mm WP t . . 2.: _:.._.m F ,%§ .. aw kfix .u1.]ol\m.»x:_uvxm\. .3. 2n E5 _.... mm _z_4;_.u ................. u|.I.‘.a1..!.._:.:..Eso._.:svszE.:._§.:Ii1:1!1!.::.._ ============================================= ./texts/FBIZodiac6/63.txt ======= wank»... |‘\l :‘ $..__.:____ um.E.Em___ dud __, $32.3 11‘: E5. ...uu§.f]s.§..!c......... E...st:._.Ja.s..:§9as5..:z§z.s..q:5: .3 ============================================= ./texts/FBIZodiac6/64.txt ======= m.___._._.;___ 1 mE_._._.E.$_ wrx n. 3. 2. NW fl 1% ,5 _==___.___3G u::_ .43: . ........................ :,.s...s.._....s...i...i: :_.§Ei.§.:i..>._._§.1_.§>.§a§.§.§3.§_.:...l1|l|r .|.>::._: ?.:._._._... . :3“..._._.3..J1§.1._...c..:f:...i... 4 . ============================================= ./texts/FBIZodiac6/65.txt ======= xssfi R ============================================= ./texts/FBIZodiac6/66.txt ======= 34.9.2. mw>_._.E:_ aua. « xx. 3. 3 .. .rfl;M ER. 1, 5 _=_.__SE u._..£ mm...» . ...J.s..s_...s._iris_1....._.E...i!..l...I...at13§I§...§..$9+ls.nl.EEil.ilI..I.-.I..........i.3...:s..._..75:...:..._._._...I....§._.EE..... ============================================= ./texts/FBIZodiac6/67.txt ======= ============================================= ./texts/FBIZodiac6/68.txt ======= ============================================= ./texts/FBIZodiac6/69.txt ======= If?) _.::.....s.s...s.,_.....__a..} >..I ...|....:1:._..._J:.§._. ============================================= ./texts/FBIZodiac6/70.txt ======= L....._.Ky__.u....uu . ......I.. -... lrullslu... .45. $_.._:::__ 13 __.. E:__=___.__.§m MN? m._..:_ 4, 3q_:.= . O9 mxnw T xfifigw, gm mm .:.E :91 11.1 rr ============================================= ./texts/FBIZodiac6/71.txt ======= .......c..>.i. . ..,E._.>_._s..:.i 22:... wu...._._._:_m_. qflxm .._m.____._..:fi u._._:_ ____m.__: F41-* ============================================= ./texts/FBIZodiac6/72.txt ======= I w.__.:._._=_ ..fi..._._..3u= 3. . an. m . Eu. .5 3 .I.:. 3" $3 4% diw .:.z_:3fi 1' ._:.._.__. 3.5. ============================================= ./texts/FBIZodiac6/73.txt ======= .-'5’ ============================================= ./texts/FBIZodiac6/74.txt ======= “.52.: E .25.... um: _.__ $_E__..__:m ~55. E. Luwm .w$.d_ .3 WV“ n..mm_..._%um fi._: ============================================= ./texts/FBIZodiac6/75.txt ======= lIlIlI.l./Ill 35.5: fl_aL._3m._ mlww. . Mnwdgfi zm._w._::w._Tmu #5: fl‘. ============================================= ./texts/FBIZodiac6/76.txt ======= :7 ============================================= ./texts/FBIZodiac6/77.txt ======= ============================================= ./texts/FBIZodiac6/78.txt ======= K‘? ============================================= ./texts/FBIZodiac6/79.txt ======= %.,n. _.¢ mg m ============================================= ./texts/FBIZodiac6/80.txt ======= J-I ============================================= ./texts/FBIZodiac6/81.txt ======= J.‘-L ============================================= ./texts/FBIZodiac6/82.txt ======= Law, xfiig m.%n,w_m.mumw _...,.r.. .._.s.i.z .......... .....51..3 _ . .. . . ============================================= ./texts/FBIZodiac6/83.txt ======= .$.xL$:1.m ============================================= ./texts/FBIZodiac6/84.txt ======= ============================================= ./texts/FBIZodiac6/85.txt ======= o|>n:Mn-1-4:12-3-m 3 *,:J J ,FEDER.|!LL U IDF DEYESHGATION FDIPA Il‘EI..E'lIH HEGE INEIIRII:-iA'IIOfl SHEET fir pggcisywirmnaacudzdyudfisiocaaioniaumcfiauz lZ|n¢In'mA:reflfEE|aE.fiO11£Nw'T1!.:g-$!$|1¢FM1fi35y "I'fi-I!Ir=1':ndi:a1nc1_' H mhm Wynn El f.1'}-UJ 1:4 mm_ Er mm :2 nu:-on ' I: cans) 4:: «rants-1_ I3 Informmfinupuialuoimiymafiirdparlywimmtefuusec m1:l:.r_~ rr;;un§L:l-,1i.;n:Id.Eu.tEJ.cLi.TJ.cou:1g.r. U '|IE'J£7}[-’IJ fltt=}mc:B3' -J51’-‘£|1J{?}ECJ 11! mm "C: wmcm I3 <:bJ£.‘9}£El cu tt-N3} l'_‘I (‘a}'C93' a. saaimsfiia U1'd3{5}' '3'3?{1J' U -:==}:i:- ca mm :1 uc:u::5:- 2: 421:4} H mm -:1 {|=J{-SJ Er txm suhjo-at -a-f:N1lL'1'\:1:;I:I:::tIr‘|i|1.u::sIJ'bj4:::t::If3‘i:rl|t‘ I3 Dammmls fl withauazlfllcr Gmrctnmgna I Tum: dm:-.mu,:n[s mm ltfcrrnd to ma: a'_ge:14:J4f.cs:l For rm-[cw amt d.i_.-cu mq;-o|35e: to ]-'E|LL P3543: contain infcrn-.aLion Fumislued I:rya.u;:rGw: Ec«w.m.wmJ a5«ca1c_xr{‘:«:s)."‘:'n:u w-man: advisnd ayuac FBI as to Us: tdn:=us:.bEJ.in)' ufT.‘u.i: i.;u.t'¢\1-Jo:-a.I.i1:Iu fauna-fizguu c£Is131JI1:a.I:Eun -arid: lhc clthcr agv:;:|J:_'{-fiI:3_}. disptritiuu 31 2 [nu .-.1aJ.;_ Paw were no: cmuai-acmx for :cLca.+,: M :11-e:_'.ra.rI: aup1'u:ac;u.: of P1§%':{:-} 'WiULbn‘Jd for UJE. fo[LI:u.-A.-mg :rI:a;IcoJ:5:I: u__ 135 Tr»: ffillmrlug Um:-bar i.s an 11$ um 1'17-I.'.r¢|T{I.‘¢n.cH:-I!I:g3m:1i.cIg {hose p135: .30JuIE:¢ crxfgh-vi 435 *#‘l-'\_.; £_**-‘ii'_a—.za'? Paafiill WiE%Lbr-’ed inssznudmasafinslmlcasc n aasuutbcm manic. ‘(nu u.-jJJb¢:a.c1rEmia.;:ouhc ><3~'Z>(_'JCJf.J>C;5..T§.. %J4?£a_7r_*...w.. % %. fig gum %£:\r\ % ============================================= ./texts/FBIZodiac6/87.txt ======= G'H.".eIa2fl (L24-96': _= mmEflDflFmVE$HGAfiUN IEUIPJ. F xJI‘..7£X.X3<. r m:1.1;-mnr.q.:;:.n«:Fom.1A11::r:s1aI:E:r .1. p.gq;}wahmamfimy:m3xhu5mhmcfluommmcumgfifi1awmgmum=m,n-uaemnmd, If Dddimswwcmakmmuuflmfltdmqfimsindimpdbduwfimmmyfifllcmmuiflavfifilgbmfw Ideas: In yufi. ' ‘ .. :3 mm :3 (ham :3 W53) U cm) ' U I111]-[:I‘.| D rt:-c:c;<>€:t;< 39' 53Q5<|.'I'.‘:£i ]°a§:[«'-J X X ="~"cI D‘ !i-_~Liun Fcc Ex‘ :5: I" ' I ‘__|; K >-T}{3“I}C§\C?§}£J<.}f}~'.7C3C.>C3'{}i}f r E .‘-"=l."i1r1E ============================================= ./texts/FBIZodiac6/88.txt ======= asc--«:ana2e2-9c- « I1 ' 3) mam“ E 1:-‘E13-EEJIL BUILEIIU IIJF flQu RJIPA DHEIED P:'l.G‘3.E- HWW 1' -34 mgaaa} wiIhha:l.dccniLtl3r'=1Iifi=1Ik=a-Eicnlilliilcfilh. Oncwmmcflfffifiioflawingsrnutnafls. uvt.-;miad5m~:¢=t. - qsuinm.-rsaauiau. 1!? De££mxwmmn¢pnmammm¢uuj§nuhflm¢dpdwwiflams¢yL1amhmnuia§va5g§Hc£er 1-clcase II-ll you. - 4:: man _ . U away I3 (d;M:51' :3 (b)«',2}_ E ¢-KT]-CB)’ E1 131(2) 5: {H3113} ' I I - J! ¢:' 'G<>w.::|1n1tn.t agw:u;:3r(ica};"'1'ou willba advised by the FBI 15 an rfic n:Jcasafii|.itg- oflhis fnilcruringmnrmasultaiian tr.-€111 we cIU:Icr agen.-:_'.'[ic=i}. Fhgfiis} Wii-§|b=itli.%1a'SnJJJth3$a.fi.IJl.a1r=€a:=as1:d:£c:n:iu;sS¢uu hasnutbex.-nmadc. Youwfljbcafiw-iacaiaztolhc *5-lfiJ0§Ei¢I3=ata[axerrian:. ' 91365 “F M! Gonfililcmd for rdca:-: 55 I112; :2: Hupucazive of Pagds) -viLb.%1dd Eu: we following n:a5un.{5]'= N “K 50'-|0"v'§Dg I11'—t-1|:-:7 is so h-u} alsod for .-.:fc1'-5:15: n:g,:a1'd3.u; =.b.::sc pages.‘ ifl§ W'HI-I-I £3‘ X.XX JCC X ]3€'.ticfl PzgI:£_'5] X 3C ?\"n Dug-!ic.:ILiun 13:: ‘PC PC for this hegc X _3CX}:Ik'I.3CX.'XK_X_§:XK}'I}..')C3|§XK ============================================= ./texts/FBIZodiac6/90.txt ======= °"“’““”‘“”"""’ ' :5 ' ' .. -3 lemon: ' - ‘ x:DDstx.': FEDERAL HUIEEAIT or flbp< _ FUE1 ,'I:|flI.E'l'EIIl PASS ‘mH SHEET £__n_5' pagagflwfitbggdggagdyflmfllddfififlflficflmflmarmnzafficfifluwingsuxanflna u»&rL-rein-ficmz, -'.\'.K.'~I.‘{X}5‘)>L':.‘C}EJ=C_3C;‘§,J'{_IiI ============================================= ./texts/FBIZodiac6/91.txt ======= - JLL"C}£_?€.‘i'[ fli!1nr;R](IJ-3-QQ «Ii. 1.) xxxxxx FEDEEJEL U (IE flGN IENJEPJL I'.|RLE‘l‘.|§£|Il PAGE 'EH $EEET w .mfin:[1.rfl$ki¢CafiMhfi¢flL0mwmucnffl1¢fiHOWhgafltmm.B,u¢&uh«fi:n¢d,'- cnqjlaiaalhiskltnion. E gdgfimuwfitmaiaywfidmai t¢fl2a=w4=n1:iQiaaIsindiutpdBr=1flwWi13lE95fi§1'fiE3H¢ 1nat==iz1T1v=i§I;é1:|¢fiut' mm: mm ~ ' ' fig";-_,-.2 . ' ' -3c::IHcII:I5§in :1 33(1) _ . :2! {b]-:'3}I;ak) 13' Ii-9(5) ' 2: mr2:I_ I:I chbmm _ _ D Em mama} ' .' u-nut-mic: maxim- _ an xuymcun :3 (tram _ '0 u:hH?}£EJ :4 and: w_ 1: a:bJI$?'J€F.| E1 0:36} :3 ih)t'4!I in {bH3II :3 mm ‘cs {tum '3 WC?) El cuts) a: na}c6;_ ' :1 mm C! luicn-.u:nan'nn1;~:rLai.ned onlytasrbizdparqwimmemfiumcctu:tu:stnl:jn:uu3m°ymu-:uq:.ru1o:1h:su.:1§¢:1afj.'nu: n:sc_{I.r.'.-.'-tisT.1':I:s:::1i.r:uu::r=a:i1i:.-.«:u|:II;-'. -- El DosnJ1c-awzerigimmdnfiahanalhctfinfiawmusmagsnmojfxz}. 'l'J:::u:::1un::n:1:u13w:I:!::u:£cu:rud mmatagmcjfu] Eormvicwaaaddituctifiz-wens: U1:-you. 1“-25¢: mmain informaxjou fumasxma byimpfircr Gm-u:um:u: a,gu:o_.r1':.-.a}."'\c'au wmbcadwlwd bylhe FBI 3.; In the riilw of Ibja ‘aunfurrmalian lnflwriugmu mumhzljuu with rJ:Ic emu a,-gen.c3r{§c;}, :=age-{=3 wimuda1».anmc1:asa5;&ax:u=as=¢=aumsnauon ha!$fln[1:n:n131ad-c.‘:'uuw-iJJI:ue§>drI':sc:d.a.s!oi]§a iiispflsilinu 91 2 E:u:m' dam. L P3£~‘:- wtfl ml cuusldcnzd for l'E|.C3.'oE as fl1.n:':.' an‘: -i§tq>]icatiIFt of - 'i7'i'."."- can nau-1: pan?!) 1*; Hr... 51):. T F‘-1._r;=(s'.| v«'idI31n:|.d for d;:u-_~ following :ca;.'uu|f;j-. ___r N The fibllunring number is ca usad ru; :c§c.J'cUI:.I:-TI:g;.2IJ'd.iAJ.g 1.§Ic$c pages.- i“!f'?"i'-‘Q’ -112 (Egg? ffifivéufl _’.1q-_§-ca Hf 'I‘fi-uj -n’-‘ff x_>:>::>t:=:::7-<;>ix;c K Dcicturj P:g£[;} X. K ?\'o DL'Ip|§i.EI|'_iEII!; Fm K T’? for I:!-.5.s iaagc X ;‘i:‘C:‘-'}(:‘\'_'\::"C."".'I_'k'_3C2I'.',',3;'_)(X_‘,!’,' 3(.‘C:‘(3f_>:_>Z 335*?“ =i.:::-I":-E ============================================= ./texts/FBIZodiac6/92.txt ======= nlufi-G:-G -M. c-.1-u-J-n.m|-:.u-rmvlzn: CH-“FILES R. GAIN c-nltr oer .-cu_:.:: ‘ti-J.-:I,;L,am E’. Eehatar, JIIinsH:|*.:4;s:|_- - - - Paderfil ]5u.naan of Inveaizigtiun ' "' - __ Pennaarlvania name at 91!: Street ---""‘ Earth W , 13.5, 213535 |'-"UL ICE n:rE:=I.-.I=:1'.'u ENT EIZLJNTY EIF‘ SAN.‘ FRANEJEEIEI ‘_r____ H-+-LI. I‘J- JL|F'|'|GE .._h 3 am pav,u..I- 51-.1453. JAN rru.-vu:|:1:n. I:RLIF‘fl?h:I_E|. 5-rung —.~—u-—.-.-.4.-o-a-a--.—.-—:....-....._._ .. H53‘ 16, 1975 9-'F'$EUv7""\-‘E " GL3: & Sufi CHEEF U5 VJCILICE - nu IN REPLY. PLEASE man.-5):; 11:.- EILFR rrI_E: 1 - _ _ 9’ sa519|:aas-*C« ithanflun: Laibozat-or? SL2-: _. ‘Z '1§:'u1 'hrI=~1=Ern ‘flit than 01'-hem remain 1111Bul'?a-11. Il-Blf ’ 3115103539: ____ __ ,5“: Hate cnvpar of Median" letter with 31 chararrt-3'13. - N. l. :2.. Du-Ecfba 2B'fi'a.'n.t Street... San F1I'3Ill!5.fi'E!O, Elalifomis 91:153.. J";-xiiulfi} 553-11145. z 11, 1959. ~’—7 ~r_,;_-.~\-:,f_£;’ Rjwfi. used. am 51:: cn'1:u1:o.g1:am sent to local ngwflpapaxg bf ' in Barge of image UB1! auhagqugntly HE IElIEl.EB‘h that 3 attempt be made to bmai: ‘mane oiynam. WK I'l:I.cut<:I cap: ti-f_"50-diaxt” 1e‘|.'.‘h=_-1: with 13 ahargctgzsg. "1417 name is -- HJOW 001:7 or czzn-=1aa.-razah em:-pt hm “findiac” letter W ~=hm-m=3-- 1'1‘-aim: Honisicba case #65-631m ea};- Sim: ezrely, E¥E.l.EI.:E3 E‘... GJLIE G CIIF PGLIGE Br= "- --Captain msaflaa 3.. Sclualar Gunmanfljng Dffinqr Pazstmal Grimes jliviaiom '. 1 \ \: ============================================= ./texts/FBIZodiac6/93.txt ======= Ol'I'|fllALlDM.lHDLI6 ,,,_ " - :Afi¥I;‘]lJw.";.}'1:.l~;'E"ES cofigenmdfinw ‘ -_/“ Memorandum 1 I $5/:::Inec'roe,-FBI n,u~e:5,*19x''.?a / [ATTH: BEHAVIORAL SCIENCE TWIT),&g"%$’,r eemct . sec, 3.41% ERA:-_I_c;sc0 {$2296} " SUEJEET3 " DDIAC” HOMICIDE-. -:}4'g3E SAN FRANCISGD POLI-SE DEPARTPIENT SAN FRANCISCO, GALIFDRNIAL 7:16 ’ °'‘‘' ' lie: Te]. converts-a-i'.inn' be-twe - .1‘, SF ANEII SA _ 19 uanticu, "IA. . _ _ Enclosed for the Bureau is an II11fE!'}1‘L'.-OI'_'f' of E‘-1'lC103uIv.=.'5 and 31 E'§l.'3lE31$1.II'E.'_E pertaining to the ZODIAC Homicide Ceee. ' Inspe¢mre d Homicide E1_- nit, San Francisco nlice Department furnie ed enclosed . material ‘to the FBI, requesting that the BMEMVIDRAL SCIENCE U'I~lI'I‘, fluautice review it and attempt to develap a, psychological profile of "ZUflIfiLC'=. fluemziee is requested te r've't;u1"r1 enclosed material and any resulting ef.f<:I‘“ts to the POLICE TRAIi'4'It-JG 'L'|'NIT of the SF affine. fliers I I r9:.C3C'j -I——u-_eu:u|—l ea JUH 2% are ___:._-mi:-u-T . " J $,\..“§§§" @ — Bureau {Enc.. 32} '. gflgfgfi Francisco (9—;=.296}- $1 {$3 ,,».*;**‘¢:«w-§°*"_l_u_,__.°’%“"“' ,£.sr..LH:/.:af;r ' W ~ 0 we * Bag» . . Levéwsgx Bumir R:g.kIerb -9:: I-59 P--;r'ra?i'£' Swing: Pie» j- —j-u-.--.-W. —w-—n—uq.- __.. ============================================= ./texts/FBIZodiac6/94.txt ======= ============================================= ./texts/FBIZodiac6/95.txt ======= .f‘- 2- DPC.-t-wcl [1;z.a—e76:| ; FEDERA]; E-U]lE.FLE.I IJF INVESIIGATIGN FDIFA DELETED PAGE '£N!“OI§1'I1fl'['IEON SB?-'E'I' Pagagap wtmbeld cBti.t*E£‘_'r at this lourecinu in the fila. cm or man clfthc fiolktrwiflg atmmmu-. whm infijtatad. ¢.:;;sI3,i,:L L111; d.-:~[a:‘ion_ Cl iJs1e:ti-313 went. made grumu-an! lu T11: v.'.w.tu;;rl:i.(>:u!- iueulintated B-Elflw Wi‘|i1119 5-"«'9E‘°E3-1F‘1° W31‘-“F531 3‘-'a'l1Bh16 £01" na].e.a5c. [D you. _ smrion 552 E-9.99% :3 chm) E5 Iih)I:‘3‘}{e\J- D -idiltfi} [J (#3?) El! I:h}fi'}~ze following z1.u.n:I'|:u:I: lain bc maid Er)’ Itfifittzrlfié ffigfiidifi 131353 1538555 4-: «mrrr .;,r a #1,; XI X Defined 'Pa,ge{.s) K E No Dupllcaslon Fa: X K in: this pa.gI: K KXXX K3KE( IXKXXX IKXXFI IIKXXX TUVJJUI ============================================= ./texts/FBIZodiac6/96.txt ======= 1='|:1-.33 I114... ?.;‘n.*:e1 _ 3 __ '-‘ "'- .» _..—‘ -=°-‘ FELI we-=" ._;-T I ! . ' 5 IA: _ 3 ,PRE{'.E.DED‘I'CE: I CL£sS§IE-“ICaTiI}Ijf:-_:,_-_-_ It . ;|'Im_mscLiat.s - - g|'r_OP_S-E.cRET' ' . : _ . . .1, I I J J I ' I '1'1_m_r{_5I_.{1'1_'-. 1'; _ :|_P_;:i<>rinv . ' |:;'sEc'.H:E1" t Rmisiugéf-" _ I:i Gui~4FmEHTL»&},_' ' ' " |:|EF’1'CI 43 cLE:.~u=.‘ .«_.' __Dm__ ‘T,-’12{?3 ,' ¢ DIRECTOR, FBI ta-«£95111 ATTENTION: FBI"L2‘-'.B0RPLTQRY._.._ I __-, .- C!FiSE'.N'_IJ'H.BER - B05-1906? El" LI. ' . - - au§19o;3_p LL-_, fix - . .1;’f==.r-. . .- . _ Fifi-Ir, I.,a]_:»€:I1_.'5‘I.1iI:v:I:'j'-'.§;,"i. _ ' _ E_31‘¢'._D‘.E‘5.5I‘-B.CB!1t.. ‘ 3 '3,-’.E‘ra:rIfii”:5*::'U"‘Exa.u1int:r:”, Imtjzei, -:_3mgaIz:a;a _f.D$fE!l.'lE|?:T. -a§E§- 3 ~ Fl _ ; »::ia.1 a|.5n saifi mere was an €'fid:z!1r=E °"'=‘"“=“"= Eflm‘ IGEEE _ §-. ‘fcsrhl had wrigtcu the E»:-1‘:Ii.:;aI; ' or ]3It»Bf- ' ' - _ . CLU-:=:Ij.|'1--:p|.iw;: SE ' .I-le stdmitted wrJ'1ing what he‘ ; Submitfiaa Uh-ice:-. 55 called Fan letters atmt £I.1'.rrJ$eLt‘ In [urn-:3: Chronirfie E°:rial'I3'r- 4'-rad-. stead E5‘J,=au]}i:1, new a free-lan-tea 5 who used Tmiili :15 El h.s'J'=ZI iii. I153 3; E§I:liI:I|:|a[ "Talea DE flu: C'L1_-r’ ::E'l"i:kL we '-two;-1 t|JrE:&"let1.EI.'-5 we-.-=3 .. X‘-"ruler: two :-'L=3r$ agcr, be said. and .] I he wrvaiderm tmm itarmt-95:. an the ‘I : ‘3.;;1'_n=; . J ' at ‘S’: was a was? foolish 1113.1-gg 1_-3 - E ’ . cu." said. ‘'1 am mews:-i ‘LL’-‘ _ -'.~ “I , ,, _. _ . .. _ ...u|-ggu-gr_I_.:’:.;<,:.=' . - gr/" _I_/ D '5'“ I I §é..__.-.u 4 fur ,—— —1urnM ============================================= ./texts/FBIZodiac6/98.txt ======= f__' I J H ‘The i:lepa'rt13tent’e'lnter:ta|, stf. fairs tiiiriaioo has Lnrcstigatccl the matter L‘ILI’é Cap’. John fifiahonsj-_, Etfltt -Jf the Iilvislstin. declined cotta- merst. Gain also tieolitted coiarngat t0l2l3:.'. as Illld-<:vI§i_ocrs_in t2te1'rLtellig- artce d‘;-ris§0J1I°“it-liioh a_lso_vras i,rt- voitretl in the iowaatigation. Lt. Jack Jt:I.i1ian. Tosl:hi‘s Iorruer homiqiue _i-15 out availalnle for com,- :tierJL J; Tbétchi has been oo the iomae {or 25 :r'astta-. the last is on {its honti-:id.-o detail. Eie nan 13-33;: as. ' fignctfl to the Zodiac case {or the ' "°]3lB8i£--\§1.il.’1§t_,h'.i-_‘fll';.S. |'..7.'..’I'.‘it\e announcement of his ' i.'l'-i|l'lSlEl" 'W:!.5. Dialdé 3]] ttrilgr iigfore 5 _ F2!-EL L-.t'tt::r a confermce lrtttwaen 5’DlitE' Chief Charles Gain and ElEE11ll;.i' £'tiie.t Clement I:-2.-ltirocet -"Elie reason. Gain said. was that 3. degattmental inoestjgation had Liiselosnlii that Tosctii, 1.tsing'-_Ejr:§j- tiuus :1-EEBES. had -written several “Fl?'l'l1F'llt'l?Et2I'1=1l‘.'f lttl.-srs 3.l:||?Ltlt?1.i!D- sell and. maiieel. Else-rgt to atfian - Ftsooaco -aritar. 3 .. The police statement did, not name .tlte Wtitozr. but he was itientilied l£?|.1"G‘3.l&ll other sources as Irlttuoto. _ 'C'r.;I.i:1 alaclannoliuced tltat thore - now is some tl1}'IJ.L'ut about the: _ authenticity ml the ttprjt 25¢ ]e1;l;ef- and that eicperis haw df,-sag:-zed up wltezlzar :1: not it is the res: thing.-: "”Phe CflI'tt'U3U.iog investigation '_L't .:'. ,.--_-. .:. ...‘-_. -_: _., .t..-3-...-.-.--._.:._ .. .' =-—-'-.---1 ‘--Front Page: of the Zodiac ease by our zosiiao int-restigation tcaot, atahtislso-.t in -0-3'I'I°'.i[ 1935. has led. to the conclusion that then: is reason to .ttool:It whether Zodiac in Bari. wrote the J!:I|1"il9‘§leLtt':J‘_."'G1i.1'¥'t said,- ".['lJB team "wits. Izoznporseii -01‘ “Patent anti Int ttcttlra J=I'.ttD5'TEctl.|>5- on and James eat:-L ' “'11 W5 given the mission to so |3I'-wt’ awry hit of the Zodiac case — to examine; collate anti codify, an to re-examine what tLa.d he-eat encam- iI'.'IEtI1 l2nEtlI2:u'l=_'." l}t_'.°.J'nir:1's said. Dafitmlcis 'l-F35 aai-ted ii’ anyone ' had Ti’-isoti ‘tho Wsaihilittt that Lise l"~PJ‘il 5'1: ieitor might have hettzt 'I\:t5t_'h.i'.s lt:In.&iI2a;|:'Z-t. “Titare ia absolutely Itatlilzig tlemonstrahle that Inspector Tosalti trrote any as‘ the Eottiac iettonf‘ Dehroicia rrrplieaci. Gain solo in ansaouncilg Toa- tJl:I.i'$ oeasttigitmazlt that "l Izonclutie 1l:ual rec:-ts‘ rt-iog insane-tor Toslzlli would he er-etttial tzuottu to the ' inspertur and lo the San Fta.m:'astes> Police Eleo:trtJJtE.'|2." Ite._g-srfijng the letter. the chief said that “there is a eonfl-Jot to the Uotttioit ot some or the questioned- '5'-U‘-’l-'-l'I?l5J't'l Itspéris who eacanutiad tho e‘\}s.ril letter and, compragugfi it witii previous Zotti.-so letters. Thks ta-tier win he ihesuhjoct of tut-titer exanzliosiian by experts.” F-ohsrl Proittsr. chief of the flttfisatifltted-domimertta section of the State Bureau oi GrL1iiua1t:leoLle- Fioatiiu: and inyuwtigatiou, said, I13 tli-ttn'I. think Lite Jlqszril: Ietta was . ..s.-;-ca;-.= .'__-_-:.-.--;-.-_-.-_-'-,:_.;<_:{.-_‘4_\_. _;::=§'=,§_:,‘7t-r.‘_£5~(-i-_,-'2-.3..=-_.‘..‘_.\______ __ __ ge:LI5LIse Zcldéa.-2. .53 betel the post 55,-} --—~ - .-. ..-.»~_ -,—.—- -- .-_.¢- ._ _-_._ _- “E examined frhotoggratalrs of’ the .-5I.prI':| latter and 1}II}5It‘.' GE ['.Ih’.l-' 1-ious ]l?‘l-t<$*II'S'$tm‘fI'l3¥.I1rt!'U. to iiofitm: and 111, my ootntort tige Aprit lezter_ ' was not wrilten by the ewe 1:uB:rso_I:I.°" Proulr; said. ' ' “sarrezrszt Eedtcr tharacteitlstltts . L11 131:.‘ ohlltbflfl fllfl Eutlt .I3id.tI!i‘i the ‘= style" used hy fit:-ciiaI:. The 5.]-'l.l'.|t of ;.n;Igug Ic_:l§,g|_'.t. was not consisaant . with prsviosts Séoojatz tootti-.unlJ1i‘3 bani lea much pu?a!iclL:r and some pe1:I;1]e may not like it.’-" , He slat: depr8~.‘;a'l-ad PNL-;t:a".5 ' erpntrtite. "He :.ta$.§rI j|Nllfr'§l"-EIEJEI operations for the 33:3 {I-iv;-go I‘-’t>JU:e Departmsnt and had. very little experience Lu 1I_1i,.<,_.” I.-Er-rrlti sat-:1. -_ “He daesrft It-93:1 have 3,]! the ‘fl’:-alerivai I had. I‘-we caught 21131:: wrIJ1Lg l-WI or EJ;!I'E-3 limes we I ruliratt to private prattice.’ Merrill scald that from new on he wun’t wtlri: on any zotilge matters fur ihfi 531! .'t“r:-]J!A':é£r.acI _ depamgl,-ant. "Armstrong an-ti Tcuschj made the firs-1 ttmtact with ma: and J was “doing 11 ior llusttu.” he said. “I 33¢.-l ' hri absolved I:cu:rt dI;u'.z1.g any more. sure, I'd like in 13-2 1112 gI.1g.I' v.-ht: :ic1et1tiJie£ Zodiac, bu: H175 is 100 r_:u.t-:h." . - IvI;au,p_ir.t said‘ this J:I1I1;rn| he :'EB!Ei's'9°~Ri‘f]'.l".-_"J'E3_" FURN A."-}_?ELET_‘f i?_E.<'5REF,L’I'-_'FoS" .HH TH£P.-- HE" nzcuynlrus-'0:-'«“-° H 'rIrATI:_R'ML '-PJPPE _ '- ' ;_:_=\- I I ' I _., .99" £: {P _ _. .§§‘n§_Fr'ant _ _ In _ _ _ c _l_“;-._~_x-,__e-._._g1a.te_1'.__:'a1 I11ater-1_ai- -ha; _a:ny ya"? us.-_,-g ‘i_t"-tar1_"§'|:[&f._LT:E.ta‘i]'1E1f"a_t=.'.'tF‘I " In" ' :r.am_fr:at?i 5 cairn '1e{;é‘9<:.“-"?:g,-Eéjér’ ”' .'?'*-?.':L'.a_l1+JratE—:r;’.§"w:».i ' ,5. :_=:5g13«*.;-é_;i:'::u'_F:cerrif_jrIig-_; e_ .h a_s'- T'E\l3 2 L1! ifii. _' ..r ============================================= ./texts/FBIZodiac6/106.txt ======= ============================================= ./texts/FBIZodiac6/107.txt ======= ‘*5‘f+‘*$*~T-f€%€%%7**?5‘?§’T?*??fi%g% j 3v % 9 6?-9M7” %‘T‘fW‘%§ a [I 130- % ma 3 = rs . '_ _ _ .- : . _% mu-._ 1: 422-. H —...--1-13. 11‘!-ffl »-.-— —-en- ' * . E " su a51‘rW‘='*0*‘-'5 J- 8.¢p,me£S5lE‘>’t-E ca‘? r:ae:ae:2u*a‘=~3*¢r*'5“3"ai % ============================================= ./texts/FBIZodiac6/108.txt ======= ‘f**r« He;r:5 %;;~.\;: % L’ am. _,.g . ' "<"-‘_'- - ' __ HELLTOQ. ~¢opE?.v aw. A wages ‘cam - saw 'a¢>.£Aarac.as£¢ =:3~1:2'::::a.a:.Ca~.£ c;.=a—*3m-5*+s1‘-.= ============================================= ./texts/FBIZodiac6/109.txt ======= L ,'.-. {S F!-J-c1"_E,ir%;%L ‘x§'}2%f"r'L§ut;% g¢,,m;;1 I3 4 : F: A \~:il-.LEIiE5:.-.':"' "I: O I er £='__~'I.-.,-,"E:_,j_‘_____ * % H _ '5-Se“? .141. £*_.1..+ <.;_‘Pu_1._s ============================================= ./texts/FBIZodiac6/110.txt ======= EEf_%ME~'. *2??? é__T“- ffcfi E 15* “ $3§§y5,§sn . --T""=_'*?_‘?“’§ TF3 3&5 ._<:.u<:H "?_HE$€ $:::§c§L§ H§aL.?E7 mé- w=»«.1;="%%'_' ============================================= ./texts/FBIZodiac6/111.txt ======= . I U.-{.L--E % Pi —E-:;1l' I D 34' I L. m9,_i.& :9 L53. 5“ _,,... '3.-rn _‘.- -\—:._—- -‘F L. _ L _ 3 . A %. -- % - 9 "4"" '9 UKE ‘rm*¢F='“? ' 1"’ ?PLA:;l fa 'Li)a’RL'xk1;--H ============================================= ./texts/FBIZodiac6/113.txt ======= LL " . "1'§.h7..'.'.'.'.'-'.’..‘.“.’.4.’**.@;",'?$’"f3:5 $5-'-—?~;_?%. _.‘-_=.=._#~w;..ss-= 6 ‘ .1 w « - '* *' I -; '%:i:€..:!3f=* ‘T °i‘;“,fi”f-i~ 6-" -_-fl-._-Eu” . . . .:—.-.\-..___ .:._—..r _- .-,. .,—_....-‘-._._-_.__.?.n?___..__.,_..=:,_..:.I. - n. ============================================= ./texts/FBIZodiac6/114.txt ======= ~ =,+ L L ?‘“L’é‘gTic:%J_%i "3.__,§;_H"f . _:~-E?-~L.¢__§;L*% T..,r‘.1;.;¢i_i?;,-';:3;7: " "L -. - r.‘.:-EL. "'.‘- .r -‘ :1 3 % j 9% .z:_$ "V .-I is-'H'1='L-sr—-~.--u-'_:¢ ¢I""-ail.-.s-as-4"! —-u--.n.g".r'-ax! I u;.{..,..-1%. -Cffin ============================================= ./texts/FBIZodiac6/115.txt ======= —";é:':a1:*"l.=».-:,’=.; i=tE:'=\ APHEIE Hppeaifizs ~ are 5» ’PflE.M.. HE um CLAiMED Etuem mcnm.-: fir mus ‘FEME. Herb Gaen: I give them Hell tag Ta deed Hell is a clue. —ThEre sausage: a name below & killer's game i3'yi112, pfirala ~ He. Cops mat ta talk-to me. Such time. Thege §§ala_h&1pfi me. «E - "‘ E31 killer p1éééE‘E mask"-r F 131111 5. ' ” A1ene,_p1¢asu;ea I'd like ta kill. scared I eat a pilll. Asshele I plan ta harm. ghane, ask. UH sells slavas because all " 1 Cflllactifin ei%her pleased ta lie in Hell. He*s me. Tngehi the pig leafls ma. Gallects eighth, same mai1 K.?. fa?- ============================================= ./texts/FBIZodiac6/116.txt ======= ..g‘9€3.” I '. W‘ ’ CH:€:jbi&CLf1WE3Lum;g15T+ ., %HE@3r+AFT+¢azM37. d with new d£':risE‘t& iqbs ahaut -' ‘flu Stine. 7;.‘L1i‘.ng, ':n:1.ud1:-.g wa. pqragmp 11:: cmlaratl iht: nzwsgispgr Lu 'gI'u1!. "'12:! I §.11a31 tin my 1'hLug.” 1': mad: '1 Cups gsusirxi :1 gm: ' nlcna-:1 E slant '3 min'q.fLe-.r 1 ‘unit the . the 13111 tn. flu. pat-E: wii.-32.13 ' 11115: |;Er;I Int. uncut thécu :::L'I'IeI:1 mu‘. ms: 3: -.5‘sr.d “ ‘E. gaw my um; n3='I:5n.g' sI.a.piI:1s-nu.-=. ->3-.a in me. Last 5 1:: 1E: mfm. 8.: I auis yes 1113:: _ ‘ g by wawelng a gun. tn: stm. _ was mi‘: 51m who was ru:-.n:n Stine cogs 5;-«:21-3&1 mhhcz 2; went am the Ecmn-."_r $3 I <5‘-.-:a1=:uan_ was ' 51:259. Lm't__ ll'E.5SB “Data PI*oces$i.¢. :39-5 ‘j:“\ro«.-.:r.gr 'l::'nj$, L-:32 52:: '_\(n- PJIz:.;-2 1--3.13.5. _. ||J‘E‘$5 Mail Room 133:’? P$!:'W'-L; .'I'€||J|. IPri4:I|5 Ls=vr_-.-9-2 umt, 5;? _c,;pz, su.;1m.i:_ 395:, ¢=|n2h'Li1|gE‘n'b\.|nLt, am '—:l.||i£3z'l tor ram" —2Iu.n:LL mm; ' " Dimchocl-.=: BLe-cl: “'“t:s-at we Fla-3.3»? fléasary >'-!-cfimu NM»; =-vi‘-F-zfilru jfainrmctkiun 's’;s';s';’s's'_s'sJ_€QEQJQSJ£z'¥s%'%s'a’§'sJ§§:'a, :PuL35ranhSu5au1d.t_, .?:Mé.T I-S5 __-r::ns1-man 9;,u-um, sms gu, Wm:-gzsm : cud 'Ln§C|:|:itI:r__ 5&5! J. Hn: _:M:rs SESE H_u_Evi:eIenn: ‘K. n -in!’ 55"-'WE‘.II.'*¢”’ :E'1:a.I=e am Rel:-urn ,.1tD'0M : §g§aa§aaggg P7. 3: 3|:B=tl'!l! Mgmt._, lEI,a'?§I Ebb O|m.r- Unit LENS §%%&Ea '-I -'.I'.\u<:hcI'Lc=J 5:11. 'LI'nJ.l__ 336‘? 155 ‘CG|'th'J.',. .!vd.I-1 Docuncsnrx aacwgaom L.IlE-EIR:5.'IDEI‘.:.' 1:IJ_'IrI;s1cJe-1 ============================================= ./texts/FBIZodiac6/130.txt ======= ============================================= ./texts/FBIZodiac6/131.txt ======= ============================================= ./texts/FBIZodiac6/132.txt ======= ' .- re‘ -: ,' -' .' RECORDED FEDERAL. suamu ms 1rw1:s7rwrr1oM - EU21,f?9 UNITED STAT!-:3 |JE15‘e1ET?\{FJ£‘€T 05* »]Li5'§'EC&; axs/":9 k 1‘ S L-'.IIw rchlry V:-rl: 555-ml latentg Recorded: B./3l3|f"?§h_ 10:15 Srnh ncr F-SC%iV‘3d= E'f2‘3x"T9 Tn." E-“LC. 5-an Francisucfi [9-2296} MBA) {P} . -"El. =-4-In/'_ :=a1FI1.Ez~:::+. 949911-"T_¢9‘5°")‘ Ii L,.q_3_ fig. EUEHEULS Cl LL ‘ E-CIDIIRC KILLER; ‘ 9' EXTCIRTIGN ' I-.oUR __.‘.U_ - ‘I-"'~r_'. ' __' 1 __ -= - "*~ - .. H LG# A-—__l{J0-'-12 Elbflminalinggi by: 6, Em-iner= j 5"’ Ho-ted By: E*tIvI1nHtEtrIIs~3H-3:5?-aim". San Fraxiciaco ' '3’-5&5--'-...Exstezsncg; Paiztel dated July 3|], 1979 Es:-amisuationmuueeteds Document 4 Fingerprint 3|:-L-'—':'aee:-a vsunvgé: 151*-' / §TE1'|'|.1E I:'|. Suspect : /5,9,/{,5 '}'¢fi‘»é’f5/'.5f7- 7 \,Q/ X Examinsati an n:-mnpleted. J.-?.'§«';' ,g'3_-"5 *;3'—;_’ Q 3'? Dictated Time ‘Date . ’ 1: E: ============================================= ./texts/FBIZodiac6/133.txt ======= |{§'!NL‘.-1.-.1‘{| M-'3-9'5) " 3 mean FEIIERAL EIFBEAU OF GAHON FGIFA DEI.-E°'1".ED PAGE |1‘1F0I{M.I&'I1DN SHEET ' Pa.ge.[5) ndzhheld m1.t'1m1}.r ax L'|I.1'51n:IcaI:in:In in due file. One ur mum 1:IFt1I.c In-Iiuwiug 5!.-3.[~3-W.l‘3T.l|.15, where izmiicai.-ea, explain this d.cl<:tlvou1. ' El J12,-1:.-.Li.=om=. were made pursuant bathe mmmptivns i.mfl-zaatexi below with no sezgiegabie Inaleaial ‘a1-“aiJsh1e for rclcasc 1>¢- WU- iigg ggg ' 552 [21 {W1} El {I2-‘Jv3"J(=‘kII 33 (clH5J [3 -3:;-(:2) 1:! {t-JmI:B:I ti 63:23 :1 {W3} :3 -wymtcp III +:: ¥“$F__L bdifi’ .»_I,.5Io:\', ca:.1ror~:~'J.-L 95-510 fiavemher Zé, L933 Being hipped as Zndisz, my ears pricked np Last sight when ans has a stag; gn the Grass Eivar Killer, out of Riverton, _ wg, Seattle §Eburh.,- -ht __ _H EIVEEton, of courss, zaminfis of Rlfifiksiée, CA; a Zoééac d 18? site, and I Learned that same ive bodies were QUE uu':hs banks cfths Gsssn River. fhene1£ an outside Chance that this might tag in with Eodiac’s preference for watery homicifie sitssfi in accord with his hbrfiscflpe Ur flstffiiflgégfil pattern . ~The'guy nevar had a.gtritt H9, using different gufls EU5 a knife in his 13:5. Even strychnine was dead in one of the Santa Eggs murder series, in which Eadie: may be the respnnsiblt. and his Jack the Ribper-type message ifl_ Riverside [threat to display female organs} hints that- zndiac might 3150 kill pro$tituEES, as in the Green River Killer case. in one massage, he vowed to kill by "gun, ' knife, rape and fire”. A UP: story {obtained by computer from The Snurcfi} reporttd the adding of two victims’ names, making a total of same 21 in the-G:sEn River case. Abarnathy was Said to $303 disappeared Sapt. 5;'l9B2, and Bellaw exactly a month -later an Oct, 5, This methcflitsl ptfiodicity could be significant, slang with the féct bath vanished during the “dark of the menu,” at new mean time (Zodiac's use of witchcraft, nr black magic). I wish 1 had more dates in the case. I am convinced that Eodis: aapiefl his black hand {warn éuting Lake Eerryesss LET) from ans warn by black magician Ateisrer flrowley during his rites. I enclose a phstocupy of GrowLey’s. Guns luau in ynur serial murdereristudya Eifix P.$. Note the similérit? béfuéefl the Rnsicrucisn crass and E059 SFWBG1 worn by Crowley and Zodiac's crosseé circle astrological Symbal. ============================================= ./texts/FBIZodiac6/152.txt ======= .._._._&._»..£.E..m . . . . . .. .. . .. . . . . .._ ;._ _._,._... .~_.v.§ ,__._..? _.._ . . _..._t_“ __..:.:.._.._ 2...: __a_x.._ ._ =.._.... ...__,_._-: -_-.-_-.¢-._ --__, -1...-.-..-....'.-_r _ _.—_..- ..__ ._._....,_._,__n,—.—.......—_._. .,,._.-,-... ============================================= ./texts/FBIZodiac6/153.txt ======= 4°” ’ b .u_sIu:-'_. «'_'.:.=_m'.:=':.“~I‘-J\ 9541? g December 2}, 1933 {;=a_:.a.,1:};._-.:~, R-'3 .. . Dear Six: The timing 5E the disagpaarance of a gassibls Qtaaa River kiiler victim, Kimi—KaL Pitsar, aka Eyka, 15, af Sélievua, fia, aassibly-caulé fit the Zodiac ”pattera”. 5hE'f3?GrtEd1?'w3$ Last seen in Sahffla 1flS€_fi?Ii1 23: according to UFI. This was near 5 full moon in Sccrpla, with Saturn also in Scorpio. The sign was Taurus, with Hércury and Mara also in Taurus. April 30 is the fiate of the witchcraft Grand Sabbat of Beltane. Thi§_al1 may be too esoteric for you to work with on your eampfitara. But I hope not. I‘ '?h2Ia have been a couple recent 1335 near San Pablo Dam Reservoir in Contra Costa Caunty, Calif_, that suggest Zodiac might have raturned to that area. I goaféd in my letter ta yen of last Hbuember 26 with regard to the disappearance timing for Abernathy and Eellflwu It was not at new moon time, that was 1983. When they disapaearad in 1982,'both dates were near full muons, first in water sign Pisces, and thg second in axles. Sorry. Again, good luck, ============================================= ./texts/FBIZodiac6/154.txt ======= bq¢,repa3 _L'1c"’ ;u_,_mo:u', I:ulLI'1=rJF:.'h!.'u‘l 5'54l|3' fig 3!;-amy Quantiuc, VA " ' - - _ _ __ _ L _ - _ December 30? 1933 : 2.. Dear Sir: The decafiitation and mutilation bf a young wuan, inciuding attempted removal of her heart, in a ritual homicide near San Francisco's Gblden Gate Sridge thifi weak certainly EflflQk$ of Evdiact . - .q .. P The Christmas Season is 5ignificant to Zodiac. He started his Bay Area homicide series at that time in 1958. it is the wihtér sciatica witchcraft sabbat period- A130 Significant is tha possible linking of this 13? with the'mulEip1e stabbing homicide of'auother waman in the' samg area four ygars ago. I told you of the numerological Sighificance of the number four to zodiac. 'ThLréLhas been some indication that zodiac may have Dbservfld the Druidic new mama, and the Druids reportedly practiced human sacrifice, aa did the Aztecs and bthers. Zodiac vowed never again to publicly clsi a humicifie, but that dae5n’t mean he wouldn't enjoy the publicity this sadistic 18? is receiving. His mentcr, black magician Aleister Crowley, urged secrecy upon his discigles, which may part1y'exglain Zodiac's abrupt change of MD. Alan, his messages were helpful to aufhfirities, as he must have realized. A5 I suggasted to San Francisco P011: Dnetime Z d'3c ct stand another 13 O ‘D’ t E reasons why. GDDJ lflck in the hunt. ============================================= ./texts/FBIZodiac6/155.txt ======= Ln Immlnu-_( T:runi-)'nEH'a| Fan‘: 7-33 .L';~;"a-_ :r..A:noBAI-out _.: __ _ . ‘ __ ._ . f-EnE'_u_ "lira!" 1 - B--59511 Ioh.'.-5.‘: _{Ihd._ {gap ' ..g- .2 J '.-;-' 5*!” -. :a|(u4'_-..| ============================================= ./texts/FBIZodiac6/156.txt ======= ============================================= ./texts/FBIZodiac6/157.txt ======= 1-um. gm-.. — Tod-my ' "‘ . -rmpomu lI5.';''’” *' "’r“-_‘1‘~”.~$ ============================================= ./texts/FBIZodiac6/158.txt ======= [.H9M'. a.g,a.az] '. _ ' __ s‘ -- 5" ' " ' ' ' Fa - . :. _-_ E _- I _ z- ‘: ' -3 '. PF|E!3ED‘E_NCEI..:'-'. _ CL-FuS3lF|CE_g Gm] . ":1 Top 3ECFl=.j‘I'_ ' - -~EI Immediate‘ -’_ "'lZI_-J_3'|'iEar11‘.3,r$_ ,I:I SE_CF_IET__. 5 __ _ . |:'.§tuufine'_-", -, - U~.C_0J5J_F';'ll3IEN_TJ.fi.L§ . -_ '|Z"l»UNG'LA5:EFTO.'. __ _ ‘ I:r__'uh_1cL.0~5"'I..'. ~ :’ .- .' '_=_ DIRECTOR{ FBI _ . ;,E _h- , ' H? ATNg- TRAIEENG DIvI$IpN**5fi J EH$“0R;HL E§IENCE,UNIfl,J ‘ __ --<. -_ _ ._. .--..- _ -- '“_’*' -. lIii:Ir':.: E:-'éL=§hi'o’].iEr:':'né_ Uep§%€: __ _ti1: Police C<:u:];iDratJ.n:r . " x -a» .; Qgfi ¢ m~C*;§-%:"*““ %a<.;»'~.§. “‘;g'-is 'é’z5fE'ie {- . a I ;%‘:9'é_*=.1:é4!'m&&.':r§'=3 .,.._ -=25: . - _fE%1§§5*3 J%t§;pt 9°" _ 4 .. :- _, . ============================================= ./texts/FBIZodiac6/159.txt ======= ============================================= ./texts/FBIZodiac6/160.txt ======= _ L 1.,-wfi ,- " sac, San a isan 1-«319-1 ' ~ <»»tm=T AIRTEL ' 5/3/34 "'a.. Dirmmr, 3'33: ,. gonna __:;zc_:z~s1c1m-: mag-L -- . -- {R am rnmcxscn, camrormm, PGLIEE o_m-an-xamr: . z;-In: ¢'/ . é-'-'1--.’~—€: ki Us r:‘,5. ___T____"—w—:T— Raurairtni dated 3/lflffll. ‘--'- '3" 5-0’ 5‘-'»=--:—.-..1"u.-.' your 1n.f-5:.-saiatian, Eeahavioxal 5:1 2 Unit §£HL_.i.s in _ 131: :11‘ original of. anniogfid lgtt-9: Emu Hr. San b7‘? f-1&1. flallfarnia. mm claim to knew the irien tr 2: tin "W Kadilk kills: at the sax: Prnacisao any area. {Attaclmd} . 5;; Fxanuhmn in rnquastrad ta telaphnniaally can t Ban msfa-:1. Ealifarnia, and name» ga _ pt. 1:! a -attm: and t-Juaik him for his after.-rts. A:-11' furthgr effort regarding-in inn. -to the caisaratiun of tin: cue Agent. - ‘mm Iettar may also be furnished be: 121113 flan rzuaulago Felice Depnrflfiant. new-—.Eta;usI:}w£;~ :51 F-53 Q (_r{ E E E5” , L} 01 <3] i 5:2 g. ‘I E wMm=,=, + ...—u—Icu-‘ ":4. E E . x" 1-4} 3 ram: 15 mm: E I :’_ \‘§,‘-t3.'C.LV5:’:jg:;:n:msa.E.1 u°=*’“=*'~‘” - " ' I ' 1 s M wwr =_n-anal.-u.; ' 5 ::::..:*=,~;3,_°,m D &* ésfc» 1-dri-5--vi. . . ix R-:. aw. _;. _3u|-. Sm-.,_;. 1'n.:..:., _-_ ' ' -In-,u....."m:L . _ »u:a-'.-5-us‘:-..._ MILRDQA If _l_} .- I _ -1. ‘__ Jun. _ I _ hmn. ’’ __ - Lmk f _ 1...”! Can. 1 ,. Eula. cu-|.1. I_ - v-L.|:; M4. __ {-5 " .. . ============================================= ./texts/FBIZodiac6/161.txt ======= ============================================= ./texts/FBIZodiac6/162.txt ======= Fa ' '1' I X33-Eflcx up-2.»:-3 {IJ-}9¢'.| 1. } manna ' ~ mama: FEDERAL BIIREMJ or 1na1'E:5'11GA.'IIoN . FOIPA ]2IEI.EI‘EI|‘ PAGE IN11mM.a.ImN SEMI‘ fig Pagc(:)wixhhcIclca:fiIc1_3raI1hi:J.uaaJ:iunin‘B3atfi.H:. Dneurmamafdscfralluwingstznanmn, y.ra.ar¢iu,aj;¢:;¢.;[_ ~ mmmmhmnm Ideas: In you ~ I: 552 - :3 (ml) _ I I3 (bJ4;'?')(AJ El fldilflf-‘Jr ' El »:uJ::2:=_ :3 (I>}m!i-:.uLi-on F-;I: X X Fur this hagc X KXXNIKKXXKKXXXKX .3CI\'X_‘\,'."-U." _|-'|;:-'|'.~r.~5 ============================================= ./texts/FBIZodiac6/163.txt ======= F‘="Q_*.5-.b:§-ss'-v;:_a- ============================================= ./texts/FBIZodiac6/164.txt ======= @315! E2 [ $'!'|'i.' _-»—a._ _- -. ' ---\_ x RECORDED FEDERAL BUREAU C|F' EHVESTEGATIDN e--12-6 9 UNITED STATES :2:-zeumdehrr or ms-r1r:E II: P Ebamiary Work Sh-2-at “Me No Lmg r_1L;s _ _ F|.e;U?IK.HD'vJ15 SUBJECT; mu... 5 :}?'—“-f'{=§C;.-"5 -W; ma. 1: In esnsnamsa ‘LL’ 1.-‘aiieju Times fie-.r'r:Il:l. Efalleiu, California EXI'DR’I’I[IIN Sacramento (E-333 flu‘-8-3-59 Date reegi-;-95.: gwgngg kn Vgxq m?uiio g/£5 Exuruima t ion (wasted by: Examination requested: Dcmuflgnt _ ping;-1-.P-1-.iut _ H-eault cu! Examination: m3’tn ? gl-.5 .I‘~ G7:-— Gar? .¢I.t2.¢-2-=1»-2» fag 5.1. mm. EIFTH fi"‘r‘EMU.E" £23?-(".33. Em. :,.:r...:..-.....=f'1~ CF": .r,.;,,..,:..,.,,.,t.r. 13:45., ~.~.r.. rm. 1-as-..;.&..:t'. ..-u'.c?I-<1-2.:-;--‘iv. 3. (J?r— -f.-7:3 fl45o-fia._+/I211-._~/-fly-_ 5f7“" *5)": ”'“T"*‘”“““”'“":°d Ca-as-IE!-1. CE’.-.+-cficrr .u,fi:'—-./7’. ‘L 9" S Ltm E e ' a.rL-:3. printed latter, first page bgginnipg “Bear '3 Q1 Three page 3 Editor "Ellis 5.5 the iiadiac 3pea.}¢ing..."' F-_' E Q? S-an-Jreli page byeginnipg "knee. I did not leave 'I:i'lE!E1'.|.Q of E ‘the ls::I'.1li_ng-. ." g .C_|3 Third gage beginning “by high hi.-ll and‘r'.II:'EE5..." and aignad U‘ "NC! ADI?-RESS"' ' ' ' Qeu .E‘1'.¢fl:ee.ep3.r of envelope pt:-$t:I'|1a:c’=}:.a-:1 “SAN rmrelzlscu, r:_:5L..xr PM 31 "JUL 1959“ hearing hand printed at‘1c'l.'z'e:5'.5 "S. E‘. EKAHINIF. San Fran, :::a1if PLCEASE RUSH To EDITDR" UC5 -°dJDOEI1'1Jfi.n3fi_n.g photocopy of 1:!-m page hand ‘printed letter, first 9352 h3ag1nnz.IL,3.g I"fle.=I.r .E!<§:L1:crp This is the murderer of the 2 teenagers..." DEE Second. gage 1'_'I§,g:'I.111:s:I'.;'Lg "E-Ierle is part of a_ eiphey -1:1-la other 2 parts of ‘L113 czphew are being Emailed. . ." _ , 15¢-E Q42‘-'»' P’l'1ntD42np§.r_9i -::J.gher ac-.compaz15,r1_ngiQ<:5 and Qcfi l€:‘t'1.‘E:r' Pp.ge'1 CONTINUED on 11122:: PAGE} E-f:» 9 -F. ALF ============================================= ./texts/FBIZodiac6/165.txt ======= QTQE mm. FEFT” Want us; E'I.¢;:_ LL} 7: “W ti. . . ,'}"',r vii‘: Cévz LU¢,,}fimrtfl.l_ Hat ============================================= ./texts/FBIZodiac6/166.txt ======= «.._,..a' -7-3 53 $5? an FEDERAL B-UF-[El-.U CIF 1'N‘u"E$TIG=1TI|C|N a_i§_E§h‘” UMTED5TA?BSfiEPARTuENTDFJUSHCE E; L:|Jun::1or5-' H‘-:n:k Sheet _ Efl La; r1‘: 33‘ uxzncux EU3JECI~ ?”°* L ¥a1l%%b E355 Hernlé, 14h~3 5~aas$2an5s LL ¢&u£g ,2 ifmmiq ;_,/_A;} axzoarzofi ' ”” Emmmfljfln Ecmlemd M; Es.-°=;a.e:e.a:;-to (9--ea} A . i»-¥~B:¥ Examination Nqueated: Doc “Kg at _ ii nfifirprgnt N Date mm-L-.-ed: E_‘%_ 53 Result of Examination: ‘C-'fi3'¥_t* ‘b‘?t"':E7(U N.]fl.u|:i.cIrI by: LFPS -...:-J! .n.a£:M_.. c,:u—~:?2.*t:. 3,, . C?v-*_+- 9%-5 M“5:‘--5 »".$' Sbccimccls Submitted fol examination .j Q1 ’,Fi-.r¢a page hami printed let-tar, fir-at fin bggiming “mu Editor This is the Ea-Eiae a;:zea.!:.'.kg..." €252 Eeaarsfi page hnginning ”3:nec. I did mat Leave the. cane -:-f the killing...“ Q3 Third rag: beginning “by high 1-sill amltra-93... and signed. "fie Afibfifififi” can I‘-hctoacpy at amrelagaa pestparknsi 1-iasficisflh. CALIF PH 21 -.Tl..“L 15$! h9.a.1.-rizxg ham: pa.°'.'i!!‘%:3-fi .:¢3'£?l°1.'I§5 “S. F. E-!A1'LIIs‘T.-:32 film Frat, Caiif FLEEEE ‘Rik’.-1:3 TE} 'z'.D}’i‘fiR"' sens zancu-npuzying phptawpy of tea page hand printed 3.I:t'!u°= first Isuzu bagim:-S.a 3; "Bear Edi I.-or Tiala is the 1;~u1-sex-er ca! the 2 tgenqgatg . . .' C=I=$ iaaunti ;~a.,g-a begiaain? “flare ix ]3=&.F¥; of =3 cipher the ether 3 Bilrts cf thiz ci1*.I:q1‘« st‘? bein; mallvd. .- Et? E“'hot4;-enpgr ta! c:'.:.1'~.-er aee¢fla:“=§.i3§'i1*-:1 25:25 and "I-:5 1:-tter 3'3-EE 1 |?.3flf%‘I'I3:"I.:’i"£5* GE-. ?i§'.E€’.’ E"§‘.&.} 33- f’ ============================================= ./texts/FBIZodiac6/167.txt ======= r.s.!.l..sL.r;2sa:s2s.l||s.. .. ============================================= ./texts/FBIZodiac6/168.txt ======= cwcmnom-H6} I j.‘1 . - J 1 FE}ER.n§I.- ITUKEAH OF 3N"lI'E'.iI'I‘Ifa'-u%.'I'IC|N FUIPJ. DE‘.I.EI'.E1 .l'£.GE UN EEK}?-'-'1' P$(,)wnhh=1¢ma¢IyadfishuIim5nmgfl¢.cm¢q-mmafmcmunwmgnmemma, agaainmjsuzler-as. 5q'm¢,.ms- .u=maa;pummnmmcuun¢-fimiuaampapusowuaaammgacgsucmawiaéwéifimarq Kala-#3: El 300. - ' I - ' |3.5"3'-R. u own _ . I3 {hKi".IE:'-J El (ct:-:5!‘ U -:aa<1:_ :1 names)‘ ' Er mm I: 133413) I - yi ~'.bJI.'?}(CJ I3 0:361} . 5:1.’ +:r:ov:7J:c;IJ.sr.sti:=.1i:m:1iuI:bc1:i1Jcvc\nl_-gr. - El Do-cancer:-us urisinsaacfi with mum: flow-nmu: agcnc_I.'I§¢.1). Tbcsc docusucurs thtxc scfcrrufl no 11131 a£fl?<=J‘C"fl31' fa! r-:vT:=v.-'a.|3d. dslrbcl rurp-olasc lo }-nu. Pa.-gr: cuuxain injurmgu-an mmislaafl l:'_I.-'-111:‘.-Elam‘ G:':s:;<;<:=c.>C ' X 0:!-:L-:ci Pa;-_-:[s) I K NU Us “Lion Fun: 3".’ -.5 |J-‘E;-‘gal X 333 PCT‘-CX>i‘-‘(3€?C..K kZ'}(.‘C}~’}< ============================================= ./texts/FBIZodiac6/169.txt ======= uE¥.':A.-:anm.ar9fi . :3 5,3 1 EEIIERAL nunmlm or mvmnannon F F0121 DEI..'ETIfl2| P$.Gl?lblFl]£EH-1:!\II-ONT? 1I;3¢{;_)u-'nhh:Id-qrliiclyalflfisln-csvimliatitlcfilt. cmcocmmewfflrcfollwriazgstsmcmcms. wh-':c:izn1.'u:n.na_ ' sgulaiun this dctcfiau. E! fl&uimuuu=ma$:wmum1mm:ww$§mmhfimpdpdmnfihmmgrcgwkmmuifl;1'fi.;hI:fir IIBC3-9!‘: In F3“-— u ma]- ct mm_ 4:: «hm 0- '3'K"1} ‘:2 cures: U <=s1{<=1_ Cl I[i=}|F'J{4‘-J I3 {|'=IJ€'3I|'C|3}' tr t=:H'IJ(<:} III -313|('i‘ZI-I131} [:2 fl:}{'D(E1'I :4 {bJr«'}{FJ 1:: 1‘b2'|!3J' ti tbJr;91 fl{|33(5}' um) U 12:31’!-} - U may I: anti} 1:: fkjufidj :1 mm cr (it?-l‘EiJ in mm C! ]'.'n.fun1JaI5.0t:I.pq1aiD¢:1.-i:uJ,:r1\oa'L'h.TIIi]J&I'r_]I"DJ%t]:1x::I:I:fcn:n.|3:mflzewbjactflfyuuxmquuzfirlilsfilhjadufyvw 1eqwp¢sx.Bii=had'Lnfin:tI1:1com1y. El D9-cumuusuriginaiaci-wi:hanofl:ca:Govr:ru.u::3t fcIr:':'\'§€‘B'a:}dd.irB:Ct1'tSp-cI'n:JC Eu}-uu. d.is:;Iosi1:E~m1 3.: 2 Iaxp dam. Pxges -contain iurunnaziau fun-n.i:.hcud fig: ;-u:|,crd1a.' Gmuxumut I-1:-lb: 1*='|I=a.aa1:-i1§r_-r of U355 i.1_2.I.'i:-rmmmn fiouon-iqmfiau .mm®mmmfiWmmEUdmflu1 a.ga14:}r{,ir3J,"dTuu wilibc advhailrytfiu: F-‘BI as ussmaflm wi1l1t11c odilcr ;gcuq-13.5). Pagcisiwisbhddjnamuchasafinaanameddamsmxiou uasuc-elxmmad-:. Yowswiltbcadi-iscadsslaibe iii 93-33 Wm: not -cunsi-ctcranfi Tor :t:lc=a.-2:: as fin.-:}' aJ:I:: 3n‘hJ.]}]1'c:n:iv-: '..'.‘E_é_|;L-|¥I_r5 ..-_¢,f .I1-'¢IA§..I'£- :1: 9339(5) ‘W1!-h-cld for U3: t'o[lou']ng rm:-cm{s_‘.-: pun ‘cut Sc.-.'.,5 *3; Th’: Elilvwlng I3'LI.n:l-cr is (0 b-::1'J.s<:::E for refertnoe-:~cgax~d.i.ng |'J1£?:.' pa,-gcsz {J '2‘;- KHJfl.PQ:I __J_-_ -E’ J‘ 30-" KM" xx .‘-'.‘.',‘€ .‘C.'€'.5,' 5 1‘. X U'.‘!rln:'€ l"‘a,_:ct5} iI::|.i0I1 Fu: 1:. X Nu DJ;-;i >3 I’-Jr :2: I?"-'8"-" BC 3 EC-‘<-‘<."~'}-'."CZ5<}'»'}€.‘-2'Zk'Dt.'3»Z3C).+é'~:»€ 9/? _ I115,-ta .Fr.5'::\,-i‘J" ‘ gs Fig’ -9.1? 197/ ya--_ .- . "£:‘rJ__3é’5'~=§£o'_ ' " _ . 4'.?:3_-££"f_.__..__ . -_.__3"}p§d5,$|:};3_ _é£:' _«'m '2'» L. j i 3 .::::=m;7' ============================================= ./texts/FBIZodiac6/172.txt ======= a—a_- n FEDEFML BUREAU or INVESTIGATIEJN ffgrqg Ll[‘f1?EIII ETA'E‘E$ DEF'AFITh.-EEL‘-ET OF JUSTICE SID Labumiury Work Shsat LAB FILE 3* mm: We *5 5-4591: mmrxm 1~J==i=»‘* n-?aa7u=a145 :.1. 00: flacranenta 5513503 3'5 Easqmimztéoa zsqu-gated by: gm; iv;-gmggcu (552295) IIIIII. fi:l1'1:a1 wag/wu "" ‘—_j 3: EznmE:II:I|:J'.-cm requested: 1,cumQn 1?g1E Cute r¢4_'-3-;i,-.re~d; Result of Examination: git/' Eacalnsaution I:-5': . fiffr J‘:=¢'-*‘féf‘f_.«§5- ‘_.-‘:9.-an-I:-('€"-E"'fl" 5-.,,_, ,?I_’'-/; Specimens aubcnittcd for Eaumiuutiqn _ .5 :7 QGEI ffinvelape nu-E‘|::na.1-kyad "saw 1-mmlsuu. mm. 1!. 25 any £3 13‘i"D,“ bflaring hand wintfifl IIIIIIEIII addzkaaaaa "'SI..*?. IF;-rc-nicle San Fran. nmxux. I39.J.5.f..“' aneoupnnflng up and hand printed letter bfiflinnzng “”I'l:.is in tha . . . .‘* ‘ cc‘? w$fiw:~ 5;’? ~ 1 42 fr ,6; 5:»? m4»-«.’ C 0 =51 B - Sacramento (9-£3} ============================================= ./texts/FBIZodiac6/173.txt ======= jg F_;a-- 3% &:+rg{ ,—:;;,o:e¢,;-3. /In:-€.I" 5-}.a—«-.-:5! ;?+¢«~:~{~—w f->‘«e..~,"(A=x—‘§ /9% /j’ /{e=~-?.fi- :3 _.g_.J.q.._;I m..,- 423*“ ’ 4?‘-I‘-v-v*'--'~v="_, J/r'“'”§ /W5?‘-’~“ 3%-an; (.t‘;':C;’] ’ ,-* :r-ft?’ Fzmwyfl fwxif gs. /firm-5,” ?¢:..,__;,_,,,, fifi r - .. 1’:,.H;..,...,,:.,.,, .:éw#~"r§:. / ¢:.¢._4..,.. ‘Q5. .5“ '7'-.e7,;~4f-e-~:~*..v -—¢4..¢.,¢_’—'§:—;.q.l_ ============================================= ./texts/FBIZodiac6/174.txt ======= , . . _ , . 4uL:uuu: EHEIIRAL JIIIRELH C-F Jm-'3s'1Ic..LT£-:II~I . FDIPA DfiEIEDFA@! SH£EI' I pggggflw-nfihdd' a:u.:d,y' a1'.1J:|.i:!n-::a£Icn1' i:nfl1=fi|e.|Z|n:urnaor:a:'fia=f¢1!.u-wfatga:‘ah::J=a31s,wIawc' ' Ddflmm:u:md:pumaxmmcam§qhmBdiqapdbduwfi&u¢wg=gaH:an1qH;v§i;|§hkfir mlazasat-uyuu. I El (i1}(JJ _ . ti fl:rJ('i‘'.I|IA} 13 (r£Jc:f:u‘ I3 It-}(2}_ E! t1=}(?JcBJ' ' 0 mil’? :1 {h_}-{3} ' ' - - :3 (h)f?]{1‘.'I} U ctlcil fireman) El (K1471 _ I": «:b)«:=:_'_I: X xx )=C'J:)E3C}='3.'}<'.5a"}i}€2€'?€J'Z?‘C XXX." 9.‘ .'1= «W - gMg#&V~ - g?‘ 5é:¥ég:G€ j$¢é%§§. 3, ",4EH§f:§4é§fi- %:!%;£;E -ffiilfifi Envelapa Pflstmarked xmmnsii-: !*mirE;12sI1:$:, up. I-‘.E'.P. 3:: PH 95 C " ' 31-11: the haszé printed addzres Eflfz 'veraide Califnrnia” Q67 Accompanying hand printed massage beginning "She Had Tu..a.." 2166 Envalopfl pustmarkad "EI‘.PEF.SE]lE ca. EPR 3|] PM 198'?“ bearing the hand imintefi acid:-Jess "PcI_veI-si-tie Piulicze Iéapt. River-side, - Calif." 3 '14 1'%?_‘<'--Q59 ficctnmpanyingc hand printed message bagisming "Bates had '.i'o..,... :-.%9'''Ii/<§1'-’¢7‘‘<‘-W==’‘?'’‘‘'*‘*°'é- 4}» 5; u '-».' '_ '_ -.: Page 1 K - {pve-,9} - ‘. gr ffiflq -- ~. ============================================= ./texts/FBIZodiac6/178.txt ======= 3 -. ' 3 r s xsnannan FEDERAL BURE s-'-.U OF m.'v1'.5'1'[GM'1nn iifai-{Iii |:JNI“1'§.§:> ST ATES 1)EE=k-1 E-tT!r1Etx*'x Gr J1.-'STIIZ',E jfl Lnhnparary 'I'nr|: 5|¢|gl- Hm R5‘ W91“ ' MIENT W‘-' ‘Q4391: EKWWW Ln" n«:aau22a11 1.1. .90: E-I.vfl"InI.nto E*3'"'“*a*5°“ FBQUSSWWJ7 Malls; E63-1:351:33 1:1-mu: I111}-Hi} E:sami.rI.a|;§-cu; ;equg5m;? fif 'L"' '-»----- .—:—....__.P5'U_:‘l_ recei?'Ed': H-I13 pf?“- REE-UH‘. cl? E::a|:rn':Ia|:'u:|r1: I J EKQm;ngL ‘ A, av; Mjgf ,,z3-»é,.;.w ¢;5’c;x— c§¢'7é~’ mu _ ‘Q1165 hauler: pun-Annual Ililflfifll Enxmaatba, an 1 ' ‘lfil hlfifi fin!-intlé mlflz-Q: WU ‘Em-"a-ids EaS.!.fn11$.:* *3“ -"'“’5‘i'*-"F3-FE Maid nrinttd minus bacninnina *-mu Hm! -:';-......r 3113: zmruxupl yeaatnnrkmd 'F£I_‘E'£R,$I2i:I£ an an as MI 15”» M.-_,;,,: hum‘! Frifltlfl Ififlfilll ”E.§.Vfl:oQJ,dg pg-pt, flwml th‘ ca:u.=* L 953 M~W""F!=H3'§-R: Ml!-fi}l‘1fi*-'0‘-‘E amuse hiilimi-Ba ‘Hutu rm: ’f-:.....' ‘j‘_ M5“ 1 {UWE} E , .:':a.-: 3 ============================================= ./texts/FBIZodiac6/179.txt ======= -—-- ----—-——--—-—--u-?--o-.-_...-._.._._-...::. . _ , 7.2 - ' ~ “$93393” —;7'EIZIEIRr5'-L E.L'REm.=' EIF LMESTJGATIGS ~ fiffll-fr” UNITED auras DEPARTMENT or JUSTICE J_, L05-nruiuzy !ro4.sho.a 1*‘ L” F“-'5 ,3 . ZODIAC . . ' RB‘ EKTURTEDN 9-49911 CID: Eacramentc ‘ p—’Iuo2|:ssu~au LL Exmvmafianrmeaedbr San Francisco (H-2295) airtel 2!E#?u B E&'-lit <:-E E: amin at Lon: , _ I /.<:s«?;:"/"' 9 I ,:;Ti:é~fl,éfl,., 49:. W55:-W:?=‘» XL»: ’,;m.,,«//»' “ ww-‘f“‘""’“*"“"”"“ % / £44., fig II. CAKin_ A;fi¢é:;flféfl fiqggf fi?f gfifl ;i;g&mA§:j;fi 54 EM; ~ (:,'7c524 :55.-$3’ .4»-M4-La. 2%‘? r~=«2»/W’ *2 W f”::*“:> Qcsz PhGtOgPaph of Eh?e1upe postampked "U.S. POSEAL SEifiICE CA Qflfl AM 29 JAN" hearing the hand arintfid address “San Fran. ChrDnicLe ?laase Rush To Editor" Exaninatiqn, requqgtgd! Doc Lane :11: — ; .;.r"?‘:—_"..—o—-s‘—-"l Date received: 2 J" H .I"T|+ W Examination U353 I5.I:'€2O:11,p-a.."1§ri_T!g 13-EILIZI _Q'.l:-*i:I'L1:£r§ ]_e$:“’tQ1-' beginning "I sand 5 think. _" 2 — Sacramento fa? ============================================= ./texts/FBIZodiac6/180.txt ======= ============================================= ./texts/FBIZodiac6/181.txt ======= H?‘-‘-'-' Inns: ?’-!‘?-7;’ IT IS REQUESTED THAT THE FOLLGHIPJG LABGRATGEY FILE EIE HAIHTJEIPJED IN THE !_:lEI0|El'.T|15£‘r’ FILES UNIT Fflfi AHEITHER SIX‘-l'HI'NTH3 F-‘ERI£ID F-BDR Tl-IE REASOH INDIEATED: 5}‘.-§_§§'.: f"§§§9§ ~‘§’~‘f§"fx'/’ r.f3*-'«1—vM”-4°‘£ ‘£'“‘—'“L ============================================= ./texts/FBIZodiac6/182.txt ======= FEDEFI-5-L. BUREAU OF IN‘-.-'E§3STlGFnTJIGN UNITED STATES DEPRHTMENT OF‘ .TU$T'/1:7 Recorded l1:3__—m L.<:t:<::s_'L..-4?. EE61r-IN-IN-‘.35 L..m=_- fieua‘,-.§t-IG3. J‘«"=* fi:"F."«-fi'=-*.‘-*4£~_'-'.\~'_‘F 5:-,.,;,$.-:§°"(_.¢.q.:r‘“' F6- ============================================= ./texts/FBIZodiac6/186.txt ======= FEDERAL BUREAU OF INVESTIGATION UNITED ST,“-TEE EIEP.|".F1’T'P-€E.NT OF JUSTICE Recorded Lvuchoteiow ?I'I’_‘|[s"£ Sheet LAB FIE-‘:2 11-?-—?C' 315.: ‘j Fla: F'iLl-e- 5 '~§—.'_g_';'E,?11 EDDIE“ Lab. 12- 3|-701102099 LL EEQRTLUH _ Lg} {II-D: Baa r-am 8:1 to Examlnutia:-= r=u:|u>=_*et£-ed bu’: FBI, San E‘:'ar1.c:J'_s<:::I I{'9-2E"96:| Airtei 10-29-70 Examination request.-_=a: gggumgggt — Fixggarprint —- Bats rmsivsdr llr2-'r'0 I31“ yta al is '15’ Fleault of Examination: .17 El 5'5 19 Examination bar‘:/y‘_";{ a’. $39 5‘; /?"rTv:§‘- if.‘ .4- ./j.‘:2'«""*a&r:.uc.~: .=-.41 =25. 43"“-ax Jgw /;4«:2;,2-$7" + ‘/_&—.w-—?—.§ d?fE : {*9 v''.;_-,-5 W f;;M<&; . :2?‘ 9.5, r:ja?cgc:*«'~r:r7<‘—5f 1* L, Q-2E? PE1:>to<:o§:u of .9. - _ ‘ _ - ten "I‘d-fl adéress F Urinda, C-3. 1970' bszaring T!'!~3§5-fi.gB cut rust of zaswscaz:--31's up ether p-:1b1;_Lc:at:'Lor1s beginning -4.a.:a;1, Oct 1.2, 2I_9?€_The Za<:1J.-a-:2 is l? gzuing t:<;>. .. _,'U" 2-—5£c‘r’-3.131-3:'&tU If?-$3} {$5 ‘:3 5»; " iv ‘If I?‘ ============================================= ./texts/FBIZodiac6/187.txt ======= ============================================= ./texts/FBIZodiac6/188.txt ======= FEI|2IER.'5\.i, BUREH5-U ‘UP INVESTIGATEUN _ F0;-CBRDED H we 'UST'5E if lG),lE},?G mar U3=‘1'1.“TE|IIE"l'J‘-.'¥'€S|ZIEP.".F1T.E F1 5 Ext:-rclturv 9e'uI.'!: Sheet 1313' f5-13 Re. F"L12 FE 9-49911 ' ZDDIME Lab. £ EI—'FfllU'15UG-2 LL EETCIRTICIH 09: Sacramento Emmkmgongqwgmdbgfian Franéisco {9—229fi} airtel 1flf13fTfl Em-.-ningzj-on requested: n‘3'3'-1-WED-‘t D-Cllc race;-ived= 1U/15f?“ esu <:u s E ::m».;7Ju:-2 U '|.'tI]Ili'i'?I[E} El it-hm-{F3 Q |.'c}-[3I| u m-:s-:- E0" 5323 {dJ{5J {i}[’2} ‘WI '3 t'liI|'C1'}' fliflfi} E|[¢+‘.| IKJEEI OCJEGP U fr€}[7} UUUJIIDUDD to the 3ul7jc.r.1 of your mqulzst or she subject of yum: El - Documents ofigiuaod w"L1J1 am:-rater Gm1or:.r 'n'<:-:1: 35'!-1%-9i_ 143 3113 35" manna: File * 5.49911 mmflufi '—="=- * n-wmlaaoan 1.1. III: SI.crnn£:ntn Examination I-9<:Iun::,i=_»fl by: 35:: Irrlnciaen E9-E396} ‘T .!-.'L!"l'.»!1 -S.-’2'I,f'.-‘ll Examination Ina-n;1’aI.-axzte-d: I Ducts received: ggnffu Result of Excmlirtcttion: Examination 3213;: - f é:,"7<'_.= Specimens submitted fa: E}!£lIl|.'l.iJ'lrElE,5a'J'l'!¢ 117:9 Phbtompirl -at two lnlrtlopis . ha ‘IIFP-Gd lsttua and tuna hnnaiwriihin Innis :11 n.§araIs.Id Innalnt to Eu:-cal‘!-rnithunr-flfla.5B Ghluumfi. no-aua'1‘§ 51fl=El5Ba.1&.nIEt:1=I'_£ FfiEYn-wk 3 - flacrustnta (9-as: ============================================= ./texts/FBIZodiac6/199.txt ======= __. -" ..—' Emcanmn FEUEML BUREAU OF INVEETIGATIGN -1,.-"2-l;"’i'D L|N1'?'€[II STATES DEF.-!xFITi*-1E}-E?‘ CI? _TU.‘ST'[CE! film Lozhomtclrjr Work Sheet I_..I_!.'S. FILE 99* ZGJJIA-1‘: File 5 9-4991: E.EL'I‘CfiTI{iN L-°b~ 3 D-J00-124=Ofl2 -H.-= DD: B-ac:-aneuto ,:.:,'L‘,,.C:’ 3"““"j°““°”“"““'”‘*‘” b-”’ San Erannifico (9-2296) Aixtel -sv21,r'r::r Eecuminaoztlun rec;-.Ie§E|:‘-ad: I “heat; : tgnalysié Cadts (9-cs-‘wad: &f23#,,i,U Ff‘ ; HE'E|-Ill U? ExcI“:n£ct|:l.t>:I1.: E_BCEIlI',.j§I_(l:[§{I:I by‘. {2} -::..e§~...-=v-.I p-_.'*£|.'t{__..-.e $3 ‘I’‘-.—''‘): 's",?_,-1'-1.».-5‘-nélz.-»'\.¢‘:'$_. A . -""¥‘-- 4:, . .«=.,.;.. ..s.w« M-vc f""‘ r:r"“ . _ -1-? fl'rG_. a?-‘-‘LL;-l.r ,a- -1 ---¢~' ‘ft-U.“ -" {J} i‘ _.:=- -:2 -’a:'w{ via/+53?’ 5&5?” rs- I’-ti‘-. Tb " {Ff lfiqwtp .::*'3'-A.-fir: J],-“:5. - . -__.- .—v— r_J__TP_h,§_ ah E? .‘. 5,3! _r|-.z,¢vL2I,"e-—Ln.. .I"?'.s——- . ' . -— 5 ./'‘'-7’''’ '1 ==-—»-*‘-.:': I.v~e't' €""“-'5‘-5:" JE3 G) 3 ‘SO Q N E fir ?, .9 ../d 5: :‘}7:__¢|g_{ $41; ..§J*..~*;-;...sr.=a¢.i. ‘rt; r:.«u¢'~'°L4_ . .._.g_ -1. :”?:r-_‘» H. S51-:4:i'rrwn5 submitted for examination JQC45 Ehotucupy of anvelhpe pustaanrked ”SA.u i'IL.§.'HCISC~4.‘.| {HLIF3-. -£3. 19930 ELK 20 APR," bearing hand printed afidrns-5 "EIi:Ltur San Fran. Gizuronicle San ERIE! Franfiifivcfig Ga11:E." first page -u:E'r1'r"' ' Q.£=41I':'r accompanying.-’l1a.nd priutedybeginning ”Thi.£ is that Zodiafi _"_J_5_?-.j,a-‘§"‘:f-Q.-_-.,,n:.';4:.g E L‘ -«-f—|'.{..-_. |.\_:¢.,T .: : {- *1-Pk ‘-‘-‘~"*rf9ér=:]- 9 Q34? Acaonpnnying second page cf hand printed. letter beginning "The new bomb is. . .. ." 2 - Sacramento i. E) ============================================= ./texts/FBIZodiac6/200.txt ======= 5,- K .. J2. ============================================= ./texts/FBIZodiac6/201.txt ======= ha ' E FEDEfiaLBUHEAUOFINvE§?manom Recorded UMTED$TflTESDEPAaTmENT oFJu3?mE 3.-"17 .-'7'i} 162 Laboratory vinyl: $hset_ La‘-7 Pi J-‘E’ He: ZDDI&C rim g 9—$99ll EIvZ’J."CIRT-‘ION Lab‘ ,, D—'?€-iII215|}53 1,1. CICI: flacramen to Emmtmfiwtwumawflbw San Francisnn (B—2295J Airtel 2313570 Examination |:wa-c_||.I-.-::':-'.-E: Qgcum-an-t flaw 55,55 5.5.5,”-::z_.' 15 '-70 E.-J Result rs! E: ============================================= ./texts/FBIZodiac6/202.txt ======= ============================================= ./texts/FBIZodiac6/203.txt ======= .94 BEEC-RDEJJJ _ __ __ N . Mggfqfl jtfl FEDERQLUUEEAUDF'1NvF£$‘T'1Ga5.TIE}N UNITED STATES DEPARTHENT CIF JUSTICE Lgg FELE L.ubur~cIt-my ‘Hark Shgg-t He; ECIDIAEIE m1? 3; 3--49911 EPCTDRTION Lab. 2 D—7I:ID12T1'?2 LL CIQ: S-9.-cramesni.--.-3: Teletyge Examination tmuwted by-: San Francisco {Q—2;2£|I§} .fl_.]_,-V 2 {TD EzIarnirI'=tiI=!filE'E[UE3tE-‘ii ilacumeut Duct-z rs:-3'uI'Ed: 1,-"z’r,f7I:I ' ‘n; Examination W. 3;. 4%"°°;;,1..;.£.441,¢£..s.»~?_5‘,‘H_,Fri,,'/_,iX.»,.-9 **%i,.;'? #4. if” f” 3. cm fix, fiywwgpéx F-*°’»=7*-'"""“"I="’“”""""'r" Slmtimens SUJJ-Diet-?d Ea: E‘-Kumiuaqtian 2~ Sacramento 6}» 5}?) 3.5" ============================================= ./texts/FBIZodiac6/204.txt ======= -.7‘-3‘ FEDEH-'5L BUPIEDLU C|F' Ii‘~|‘1’E$T1G@:T|I'3'N' UNITED STATES DEFABTIIENT OF JUSTICE Luhumturr War}: 531-get ag=xc>'1:~I.r1c.; n g =?»¢’4"r‘J'I Haw mg; rzwc: Exemrmi Tram ’” 7"” ” £ '5 9 2 '" ‘J’ Emrninntlan Ietzuesleii 1!-Er‘: 13-F‘!-"aid;-:.f Rffpfipef , filqfid £41,: «I if J CA is L _ pf; 3 Examination Iequeatecl: H C3 11- I? M c M1‘ Wmtg ..3..;E.i_u3.;|_- 1' ht F156 I:]|: DE Examination: I'- I5?¢1=-: Gt-‘I*:‘. I‘-Panza;-C?=3:1 am Fm", s.;. E:-::: rn-;':I.at'l-an In -3:4-:-riiflfy §nI§m.'1‘i‘5.;-J‘ U" W'r-2'.-’-H. Envy .«;s£m,.'».»9:_-J 5, xaaur,» 5.2: :.:f.:n’.-;. 3- -''”1‘1 /"£Eu:_'!{6NI:l'\-‘J !¢f"'c.;Es iflff-L: ¢4'I’:-——-5~.s’n:cmi.m::;n ({»'ct;3 Pl;g+ee_g.n. MT eudafofcit fra5—|1mHun’¢e:s1 “SA:-.r F.-1A:.h:.::s~:;:: 1:51: .10 yes? Pm C.-9 nd'Jee¢suI' “F31?-~ m*_'-'**I'“'° Ball]. F;_z€ 31%» Fla-4 Cflflf _n. oi. _.e’._ , ..e M“... A.,_.,.. :._, . Jeffene -$‘r—_'5r’«-4:-'-3-I-, *-ts. .- r u-D‘fi£¥ gmfifvffl _i.,}1.Is- 55“ +11: ’2d:l!h.a.c_.‘ jfla-A. I |.q_1-|-SI-. yin-U Fl I11 E4 1'|"l¥W5-5.-In -_. - ,-2- Sm-.::.-we-cl‘? @'‘'«‘-‘5‘) W ============================================= ./texts/FBIZodiac6/210.txt ======= 3. ‘ye-¥3J_(j?:‘_qffp‘ xu=¢?§;./? . 9*“ Mr‘ Péelvirfix M. E7&m .r—. F /<'\ / fig? Fr‘/an C51./:'!( F’ (Pas.-'9‘ “H-.’.; :5 +3‘-E 203*“: ‘Finn :3 if *:'‘*/£ -’-*‘--’/‘''’’'’7( E‘; / A3/:}M "“""'”'i htka Jgdg, #2’: gt}?!-I;/é/If fa/nfiyer. ,«;;¢L;-1/’ ;]¢r"r1-:z.J.-:a¢n 1:0»- ============================================= ./texts/FBIZodiac6/211.txt ======= FEDSH-‘KL ElL|'FIE.'5.i.'§ DP [t‘!VEST[G.5.T[G-N ’ UNITED STATES DEPARTMENT OF‘ JUSTICE Lpdiloralmy W'a;,,'-: Shea-L He: fiialmi File‘! =<‘3 13-‘qr-+.nr=r-Hv of‘ -=-.r=e-=:n1-v.-:3 x'm.=.r-=:'-~h:==ar=i'r~:e- fl'l:'F.'-*"‘I1""" D1‘ in-'n'=I‘?-:= .2-an-1 hh,-3 message ‘”J:J:I.e fiJ.nss4:%_‘é_ng 1in_‘i1'3 or '.-.'.I::cl.J'..-3.4:" .a-C'r1:I‘5*-. 51:39 Phéhncfipj of aznirelope postmarked '%a<::1-amentu, GA EEG 10 1969 H1 . ‘*3!-An" 9«<1<1I°~9-3-Bed. "TEE szac:H.0.1~LEa«"J:t3« WE 1=.n. Ba}: :79, 5.u.cR,m_‘E_',1{'I'r;;u, 1;, $9’) CALIF¢FlJx'l.|?a. 95$:-L1" !l‘- M! -.:'- a:::c::tLps.¥]3‘1ng it __ '1 ||_ rI%1¢E.:.G Photo-eop;_r offpage Q. from astrelugjr ho-:2-H capticued .E:uL:.-BC1'.'—1IIAK - FORECAST FOR cu-1n:ER;‘ page 59 ¢AF“$- C.g:3J4_'l. Photocopy r:-I‘ envelope p-:u§tma:-im-:1"S arr;-'E'ranu'fiT;:‘.a, CA DEG E 1969 PH" midraaa-ed 3 "sum Franaiace E'T9H§;pa.5:I-BI‘ Printing, Go. E.IZI. E01: 3100, Hinton Mme: flax: F1->s.nc1s¢c>, Calif. 914.119“ "“'-'-:.-us --" L? 1'1. 15 f f E ' ' ' Q:-._ fDfi_1_E%:_<:_~EEfl§}_ F%§§gu;1§%n§"é_%g_ 3%; pggfl Eitrology bf:u:>1-. ca.pta.q>ue»:L 2-" S,IfC'£,Ffl'}l¢-Ijitg. »'-"1! .1 ============================================= ./texts/FBIZodiac6/212.txt ======= 3.?& ?@§P'?“" £752.»;-v #5:-4’*"é*.r é3%=:fi~, E fih 35'.’--1:...-1--"L ___.—-——~— ,2“ 7."-”"T_—'""__ Cr‘*-'-3'3 fa n 3::-am1w;«:-:> L"*"_“~ hr-um~er~ Gd? far fée G-c:>‘+—"§- €»L‘FV1f’h7L ' jG?rc;h’?L .Jp0r-€gff flag Biee flung 7*‘ 636*’ W /’ ============================================= ./texts/FBIZodiac6/213.txt ======= :' FEDEFMU. BUREAU OF [Nu5$T[c;1'1']mq EJNITEIZI STATES DEPARTMENT OF JUSTJCE L9-E’ FILE Lcherfitory Work Ehzct H“ an-nmn: F'i.l¢ : 9-.-19911 xrru-mans: Lab. r: "fi§" '39? 3‘°"""“'“*9 -’9‘é?.f.‘.2-r?pc-3.LJ’.. |.?_ -1 i 'i' -E ammfiwflufififiuifizdbw nun rranc1sé;, a1rta1 dated 1339/as Emu?“-1li°"Lr9=*~'='l"'~'=*f'=-=~ raznted r-aw in-utiun 3-, 47.: 3sr.:.- Q3 M% /.~z;,au—~.t __ QG34 flop.-r of envelope ndaraased to "am Frlncisno Chmnigla," p-natnnrkeli Fniriield, Cuiiamia. Danube: ‘I, 1969. S1235 lhpr of hind};-rlntefi wnnmlcatinn b-IE1.Il.ll$.lIfl ""I‘l:ia is thin ‘fut; Zafiiln apllking I just need halp I u111 x111 aggtn" ‘El: and mdLq ,*,,,z ',F,_. .4; BR‘, ' -J .‘\: :~~_. ff‘ _‘ ‘S45’ ============================================= ./texts/FBIZodiac6/214.txt ======= G I ' 4)” 55*“ JL?"'¢5’-hC‘_.!5co 7 C/7r°/EN/J c /: CP¢;3§ '_;‘_"r“'?.r5' .r_5' If 20 of Ir £"**’“'wf/ at.-43,; H”?/I ,-»m.,1.e ’’ //7 NE" #5? 1/ax-"‘/,9 :4‘/:1’. // ============================================= ./texts/FBIZodiac6/215.txt ======= H . ~ _ I. FEDERAL BUREAU OF‘ [H".I'EST[fl--'-'\T1{}N ‘UNFFEU ST-RTES DEPARTMENT CIF JUSTICE Laboratory‘ Work: Sheet 33-: :3. $233,234‘-:2 Exéozfogaw pa; fig;-: .r€,c:H'T't6’.av~.-"7‘{'-'J Fl]-31$ ‘5’*5““?€"" _ _ Luz:-.aL'7,Tt}—.g<‘F,¢;7IEO<,-"=5 A .4 AL xgzfiizéfi Qqtexgcgiyedz "'.:2ffu’f.v" 194” E-7=«:ITrI.(::«:I'|:ja:r-rI'b1_-r“.J£Z— ‘- * a /gig: :52»: ~ x f c«—~=—-—-a. _ /Zgéiofwvj Jfl f_.;Jl/C, if (J, _ A. jgéwwflgfi fiW.ufi:w,£’,\ area - .4”. Examination (euuc:-it-d bar: -5; ‘E.-6:1 4 EN miwaiclzl. |.'EEl|lE'5lE*d'= ‘C-L7‘;-=2. urn 9 H-?5=.|.|.1 vi Bxixminetiani I» ’??C j‘- *‘5-¢“’- ML. 11¢’-;vL~a'4=@ E {$- .2- ‘ , :7 C3 _ lg‘: R. 5 Jf£ EmitE9d it-I: Iaem:rI.'-i:ucrt.;'I3n fécs; WU #7" ============================================= ./texts/FBIZodiac6/216.txt ======= .J‘(:.%«_-=32". /K/§7#E'7”f’/6 ‘Q3 E £~t/;;C".:rx’//ii Ma 6% :e’;J,.‘: 6‘/“f""(“’ :1 }LJ'd-'f—I:. £7 wflzgggf //1, Jig};/‘:, N‘ 72/” ~é?a#é 7}/X an? ============================================= ./texts/FBIZodiac6/217.txt ======= T-:3 FEDEFI-‘EL EUFIE-WU OF INVESTEG-KTIDN UNITED STATES E|EP‘.5.flTMEN'T Cl? IUSTICE Lobumtcvy ‘Hark She-3-l ac.-: ZDZDIHC, Fuee 9- ‘I’? 9;":-" E;-cfm-r,4,Ia~ ’ ‘““*''**I>- 6%’ ;am5’.,2 A4. at -e: 54 a: it Hmcrnivla E_;-mmimtian requa-sled hp: SFIC Jiflfiflfi "-J1£¢~'-' @- i'4r_I‘1'..?(E lrr '1-rfi Examinalion zeqwaated: -f.)r.'3<1 0 F1‘? #3 .-NJ ‘PL Date received: -I’./A2 / /(I? 5' an ‘* flu.-.-nit GE Examination: E.-'i'U2F|i|'.IC|'.‘§I2I1|'9: l' _ _ _ I . ~._, S-Macimerca submitted Eu: -9-mqmirsqlicn finjflhf Fm» £ ; w ) fin-alvrv/é W . _..-: /_«"‘_'_,«;-’—,,_'_,,';3.,_ éI..=7»@g— cw: HE é:.,_..é7 ============================================= ./texts/FBIZodiac6/218.txt ======= J 5%.; . flyfi, MM“ M» M‘ Ta- };1‘-’ .,_ :4 -w BETTE 75- E"z:1'S..'T‘.:rr:N “J/4:355,-_.-1/1|”-,r_‘-_' 7-E.i=.<:,HE=’?~ N)‘ r:.,4:_ vu-r2.rT‘ER, :2.-::u’_r_.,&a-:;¢r“ ."—"1[2_T' .::_r-HE'S‘; ,ST“c1. Cami. ocraksi-L’; DL:-§2"*<~.BX Moat‘ Tc: ‘SFCL 5534:“ F"3a"¥:Ucxr;cu, C 9.1. / Q3-:33 t’,/{T.'¢;=rlte-Q) E4 H: “/4 f _ ..£,«,-4%-I-'5-—=' ,7{j.2—."/;:_t‘,£ “£3”/3?/'/{'3' 2-/E;-‘- /Pfiegijyf ============================================= ./texts/FBIZodiac6/219.txt ======= "I. ,1‘:- _.- I FEDERAL BUREAU OF IN'u’EIST§G._-!¢TIC-N nu -F-I-LE UNITED 5T&'§'E$ DEF‘-‘3lfiTF-IIENT OF JUSTICE fil T-an - W‘ *3 Lntthumtiury Work Sit-32!: R5: wsuflfi 1-119 as 3-L+991_1 "Vei]_ej<:u Times — Her-aid," 1|‘-silejo, California. — ‘i'i-:21:5_m; Extortion UCI: 5£CEt°u"'1Ei‘-I TU Ln1I:I.§ |‘J—E3l'Ll*H1-53 EL Emminntionr-a¢’a Sheet P.a:I.‘FIEIiNOfi'1€ SDEJECT; rug 1»: 5-4531}. WILLEJD *I'I%—E.E1=.A1.n Lab, 3. 1::-591027115 1.1. Vallejo, Galifern1a- VICTIM‘ EXTDRTIDH . *' 00; Sacramento Ezaminnlinn rstv-tsslsfl bra’: Hnuatun (9-HE?) A. lU.r"3i.v"59 Examination requested: Document - - DUI.-9 Ieceive-d: 1D,."'2"J',-"69 . . bqc’ . FE-ssult at E3r1 reqwsteflt§3¢ ’4édfl 6'» xafnefse f,flQ_/39 Eawmieetjon requested: Date t9C2i.UEd.-' 1'53 __%u1t of Exclrniautiani bf} C...Ex~:~c=~:izvc:I:'u:-at by ,:t. l "_:fls1»..<. .e.-M-I‘-e-4?. ' :7’ #* 1‘3F'£*=’‘‘’*’'~‘ ,c.;w2‘>»»>~* % $6“? <~*’-W é ””*“‘”“Z57 /7#%g£ug;,»’ xajgsrfrse , age: _ Maw: A M 4%-='4=‘-*~ fimxew If we 9 ,./ 67¢ <3 63:7 49:3 7‘Z''3 J} /d/;"°" '/J=:ax.};:,J’f{=i/. oz’ ma'.g--- ‘- x J / ;\"y"L"‘fl C3/@265 K!‘//K»? - - /" “W7” WJW”? S'F‘ C:/‘a7I’‘D:'''”1{.Cfr;;j \ M '3‘ as ============================================= ./texts/FBIZodiac6/232.txt ======= ============================================= ./texts/FBIZodiac6/233.txt ======= '5?¢—510 _§‘c—/éodx Cir‘/C} I-—:=._, ’'’’’‘’.?r-‘¢f-''.'c‘’ ‘/ :47/:15’ T-Q“f" fflgl -1'-5" ============================================= ./texts/FBIZodiac6/234.txt ======= 1-‘: . Bflfiffi-3 FEDERAL BURE.-'4.UGF' ENUESTIGATIUN 115$ UKTTED STATES 'DEIPAfiTh1§}{T CIF JUSTEJCE Lmhmvtosv ‘mark sheet EH 343 1'13-I3 H3: §.&"£R.WI' Fils 5% 9'!-4&1: H $ maancrg Lab. 2 E-«E3331 ‘Li- ? :39 T " ~ _ munga. .m.u.:.-.-mu - " C '9‘ *'*-"€«“t"“’ ncril sxwurnwzm E"“"'"”“'“°““""““'35*'3‘l ""“"" fincrnnentva £9-$5! .a.1.rte1 E-flit/fifi Eskxrnimetion l'EQ|JE$hEcL' Eh-lB.h1fit_Jl-*%°l.Fr.j_nt_§.’nt_ D-ate rec-rive-dz Result at Excl rH.im:Iti<:m: l7l1¢E:ccm:i!|:cI 'L<’Jt'I |:I : LFF5 ‘.. ¢/5.-$7r’.§’ ; Y SD-3-:Eu.19;13 aubmitted E01 examination *3-£16 mvflnm peatmxhad :3 ma ii 1' ‘fl:-*"' ‘E’:-119.39. £11? I Aaeaawaagriu white 3* £ 5*‘ and bar: txrawlrlttan mt: iaaginniux "mu lngsin 1 huge the aaflnsafi "&;"’,.."* Q13 mm; at‘ that guys: hunting uni mind lettnra ¢.ndn3°n.‘I::I:nl.s]:sge§1.uJ:I:I.|ag"§l—&-S-r bu." "film P19!-Beflilcn mitt. H W -_ ma tfirtti-an andsi:-nu gilega Poll:-5 Dayuurtnaat fin.’- iéa £121-<4 3'-’,i=i-sacs .<$‘}’ ‘r §€- ============================================= ./texts/FBIZodiac6/235.txt ======= ._ , __; {tenor-fed W13/G9 FEDERAL euaew or :NvesT:e»uu3N *1“ UNITEU sures neeanmewr or JUSTICE Leberutoty Weak Sheet Ha Lag 3:13 3,3: LATENT We ,, 9-4991]. “Q. UTHDTCIHH 37.33-ELECT; "'Va1].e_jD Times-H«er3It1"‘ ‘-.fa}.1e_3:r::, California - VICTIM EEEIWERTESN [__uL___.3. D-5~QO«‘_'=l_E§{J6£3 LL Exemiruaticun cequeated bv: Sacramento (943) .'?.|irteL E,-’1<‘=;"$9 Exu min-1tion requested: Dun: L1l]'lB_D'i.2—F,1-‘_E]gE'i"13I'_i_§Jt-'CJ:‘:f pt . Date IE{Ei.\.I'E'dl 3,-qéfififl _ _ _ "1' V _ Fteeult -:IE E5€C||'D.J?|.|:|'[|.UE'|. Exummuzticln ba- . _ §j,fi,;',‘Jx:—. 7“ :3”? ""‘ M74 Ian. M. .1 .--r _ - ,t.,.,2A( v--3;» """““‘ $- mtens submitted Ew examination ‘yr Q16 Envs-large postmarked "fiat; Francisco Calif. 315:. PH 10 MSG 195% " aria the typewritten address L’ sISe:g€:EA31 '|p'e.§.E.ejr,: ‘B-:,I1d1ce Department ‘'9’? Vallejo, ; ernia Q17 3' flccofispan;-ring white 3' 2: 5" car‘-i ‘Marin ‘t’ tg,-;:s-ewritten note beginning "D-ear Sergeant“ I hope the enclosed ‘ise_',"'..." Q18 EH1.-3.‘-Ie‘t of white paper iseezering hand sriuted letters and symbols 1Je,e;in:1in5”£§. - G - S -Elnackwaréfi? L +«-" Return evidence _ ._ ‘_'Em'%9"5°‘-F~E5E'{3 ;1— 5-F» ============================================= ./texts/FBIZodiac6/236.txt ======= G-<3 ============================================= ./texts/FBIZodiac6/237.txt ======= ...._...-.....-...__.m,,.. _ _ :3 _ . ._, J ‘ FEDEHEL BUREAU OF‘ [N'-"E5TIGitTiCIiE UNEPED $T-'5I"l'ES DEPAEITMEEQT OF‘ JUSTICE L.cI§H:Iu:It<:ur1-' Work Sheet Examination tsquest-ad bur: P3, .*-';;1z_e_,:-'¢_ -:g:_;'«*- .-.'_._T- Examination requested-. 3n e:_-_n-._a rt 3 1:.-4’ Result of Examination: :0 J. 71:1. la, »¥»gF- 0‘¢=—=19—=:~'--1.-»~"’7*‘-r. g1..,$aJ-4. Mlcr 6ruL:’fl~g"%, 55?/7Jc?7FL£ r§7'9—- £9.25. :2‘ 751$ . Specimens sabmitlaci for ggcqminqgtorg T -T'F'i'-fl"-‘I-'3',-I8 5.5" 9% — $".:"’u’_=-.'.:;_‘.-a. QC.-‘E, pr'3u:;'.o:_I_ gr gufiqit-:3.-I by 5"s;r *-'.":;_-_-,-e-cl.‘-.55“, -.*-1I=;,-“wax-3, rrsr’-er :51-2:3-.»: afa $.59//nil - “ ’ " B .E:'..:r:§:i-or; for _<“_.;g tearing; .-’;s;_'u:j.=1 afrat -,"_.'c:'.i ':’:;-_ro 5.1:: 12:19: r'ArJ3z:.1' _'3J_E:j1.‘-325;‘ S?-5‘.-ii!) -9::-2 F“.--_-.-.-an-:;.3.—:¢ ,:’:;:..dg§_31 E-F4‘-I! J;-:u:>~¢_'-,.?_=g{_-.;u :/Q_5_i‘{':_>_.I 2' ============================================= ./texts/FBIZodiac6/238.txt ======= ============================================= ./texts/FBIZodiac6/239.txt ======= F I -. Qlc<' =‘ ' 1 .. - ' . . . i- I 5-: -£h'$5'{_?.-..Di'.!£3 1‘,-Q3 .__=-5.5-5&5;-_t‘ 1I:~:-E,-__I :.Rl_tJ:,G:E_-_,’G:?’ Cfizl?‘ 3:3. 33- J"3+ .E.'~.-‘$3 "'1: ' “ =-‘—’—'=:<‘:.:t*= E3:-.“~ E- - —. A ,. .—. . .. . ._ 5:“-=1 Eran. 6:335 :e:.2:.T§cs §§*§r%3t§€;f§:=EE““ "-3- %+ .%~t.«*:-E. .-:3 - - - ‘-‘Ar - $- ¢'.c.=: J. .FR‘’:'_’‘-''‘;' 554': 3-34: H:s:.;;;a-1__;?.-1-»,a',-u . . L " ‘P ":9 ‘ . , - 1>.=3;.‘f. p23§_:-|,t¢.;_1 géth .-.- _ 05-'r]“_:_-__:-3_-G1‘:-.¢. Ii-1 fi__ __.. 1"’ ,=_ -'_ '_ ' I “L”: the 2 t‘:e::=.‘a,”»‘..§i:§g...=:“"‘ ‘*5’ E Fmitar . ‘hm 5”’ 3113 ¥=''L~’‘=s'-‘«'3€'—‘€G1‘ Of . “Emu.-'_k ' - *'-2:35 4a¢ gf Ea-vita . . - -__ L "'3-’ ""-'Er_5$$i.-1'3‘-.E3£I"§": "':5—§!Z‘(a 13$ 'I3r_'.g-t nf ‘-1.4 .,- . 1,’ ni‘-"'1‘5*r' 2 $35-‘1‘—$ {if this 35911:: are ltirifig tB::f.}.t‘:'f3..."a Llifihi the W3 5*'*‘5"fi*:*E~‘3-5~3-‘—(f>«',‘3C_*E_3~.'1\iT?(.3C }-THC‘-43‘--'.'-{P-I .,::;:-:1-_= ============================================= ./texts/FBIZodiac6/243.txt ======= mcmm (13-'>3*'95} ' :9 ' «E 39053:‘: 3' mmmwcmmpmmmwmmmammmsmwmwmwmnnwhkmmfiawawhm {dawn WWW ‘ on 5:: - :3 cm} I Er au;m.1:t\!-=:m1H:'E::n't=d toahztagcncyfits} Eur ,n:vic-xanddintu L61:-4:-nus: to j'I:IL1. Pays mum momma fmmjshud b_‘.v'acucrI.In:I: |3uvdJ:Ime:3t agm-swan, "You Wiflbc amm byline FBI as in the ,[fl4:a5a1:nE3.Ecr of rhis iI_:I.f1Jm:la.£icII:I. fu1EcI'l§‘5:‘.|,ga\£1r cflu5l5Itat.[I::a:I with {he 1:Ifl:u::r agcucjfifij. _ Pagacsjl wiLhbfidiudsmucha5afin.aJI=1cx5E£—Elcm1inaLEou1}5asna:b¢-enmaflfi. Ymgwiiib-:adw'se=cI.s.:q-Has d.11;Iosi1:io\xI.e=ta.LaIara‘.a1c_ _ P35-B were mt musldcmd for rclcase as U22}: am 'du;:-]in;a:1:ivc of _ Pa.ga-{.5} 1h=irJLb-alti for U1: fol]-uwi.ugr¢a.3uu[sJ: fl Th: fail:-wing uu.mb-cr :i: in I1; Used fur red’-arrzuoc r*ega_ncLi.1Jg |J1r:.-c pug:-.3; Q’-ii!“ 92:15 XX PU{HmGGC PC Dciucoqi PrIgr2[.sjI X K Na |3M;p!i-usxion ]'-"Ur X X 5?: I|J_E5 'p:::I.: X XXIDIXXNKKITEKXKKX .r-Fa-"!'J'¢1F ============================================= ./texts/FBIZodiac6/244.txt ======= _£g;['e'_r'3ra__:3e ":B::gs£c'n- airjte 9 ='I:| 'EI|:J'i:'I1'ife-‘,"_::l'aaLt.'e::1'-5.-"IE 3 _£__ urea1:_'aru:l _Bcr5'.:'::n:-5;. in rj'§;;1f;.‘§-Zo%iac- 3:__ase_.1.g'as_ nu _ar_.,_;. 2 '| ' '-{ F-Dlsim I 1321-315} . (Q1-t_§I11_;:i.¢_c_IJ_- ============================================= ./texts/FBIZodiac6/245.txt ======= -___-_.- fix? ._" ‘l ‘av _ L ., I 3}%éia£U5B5 and SF ffofi EifeétEr}‘FBI"*°"”":“ I Hg A Eodiao Killefi; and-_ _J Jaan'Hester- 10 ml _ ._ “ ' 'For thé'1ufor&aEian5oi a¢si¢n4_ffiF2renued "'2 _ San Francisco airtel to the Bureau and Eastun set forth ¢etai1S of the ifliiial contacts batwaen the FBI and _ ' Subsequently; San Francisco Submitted a considerable amount aefrmaterial pravided by for analysis by the FBI Lgbaratory. The Laborator cauld reach no_éefinit& w@§q¢aly§jon éonéérfling the material it has examined ang ' as indivfitéuggggarding.3amg.of anagyais that*thé'Z hlH:qf'hia“théory i3.baseq upon 3 equ;ap;on pnq,a.mfi§pi;yfie___F a's§u'nij—.at‘1'c'ua' meiv I.‘M:':'or'a£ a'~;'.r" [2Ii'\riS':i.'n:+'n-":'._Ir:>t ad ‘that -_i._t-.’=j'i,=.=.;I';"_‘_- .- ' - assumptiofia?éfe'éo%reat; but appearadftojbégffirbed Hifih th§;~ _ _ tively;-5The_enclqsed_matgxiq1_hé$, 1“ e\Labo ofy‘Dij; ififi fin Pahfilf 13. '.'—-_.~ 3 I‘ _ ~_ “letter make‘;ré;fe'r'éric-é:'to'_ . . ._ , _ _f$a;hom£cida:;naw ch Joan Hébs£en~ _§E§hg}yi9fijq].: _;_nfiiQatea"that v d Uniuérsityifiplia may7havé;§afie_.”_ fiteféataffi' ung 'hfh;fi5 1§?ni§*fiQ$péchj=3¢ 'in;thé'Sab Francisco area Zodiac 1 ing5' fid-the Hehitfir ' ggqlwx Aqcqrding1y;¥hhi5jmater;artghauidfibgflmafiggaggiya 't6T§Ofifi"EusE0n and Harvard Ufii¥ersit$ fidlifie-éfihHoritiéSI"73 Efiiflfi-will not forward the other mafieriala in file.-fp'.; . H r5__e-rioI.l.s13r pravicied t:-arm or _the' Lab-:-r_atory re=_»p<:«rtgi_ 'f_-__ _pfior analysii unless 1 a officiéa1s.at Boston and_Ha?vard University axpresa soma interest in them I -='*" " ”“ '\ '.-=4 ============================================= ./texts/FBIZodiac6/246.txt ======= ..' =-:ut.u:-=1 I:I§Pn|1:?-MENT -3 . "DID: CITY AND EIELINTY BF EAN J-_F!_.Ii\N|:'IS|:,‘|:| H.ue.r.L qr -5.I.,_I51'ICE POLICE rggu u:'r:\:u'r :rngg.- :=.A.-4 rn--mcnscu. I:A|_lFclfi'i\-I.‘-an ?-1| Ea pr.-u == u.- -a-: CHIEF EIF F'E|L'|3E +=-an-=-=-= .u.:. =::.:m.n.u=,a.'\---a-¢—..- ISEIHHELILIS F‘. MURPHY cl-us: ar FFULICE IN F!EF'LT'. F9-LEASE REFER TU - J/__ . ELIE FILE: T4. '1-Err. William 1-Iabstar Director _ F.E.I.".\-s~,; " J. Edgar Haovar flag. - I H Washingtcln, 13.8. 20535 Sir: - -~;'—_"'»_u..I,_I:;n;>gL:‘l like to request that your :1-gancy send 11.5 1:1 ph .3 hit: ' -“an-guias 95 all Latent: fingarprinta in your files Ivan th homicide cases 1-.'§11'.v:h occurred in the San Francisco Bay Area ' arcluad L969. L L V W"? Please send the. material to the aI'_tant.::un of ]nsp12::.1:m.' Crime Laboratory, gm: «*2? »r 2 FE? r.r:=- If 3'UL|. have 9.1.1.5’ questions please ¢_crrI.tact 111111 at 415.5553-L§{|E. W Si:u3:eJ: E11-' , 108»-'i:'N’i8E9Sfi " 10 ============================================= ./texts/FBIZodiac6/247.txt ======= l:‘£lJEIhlii-,._I1'.':F_ ifiv;gtiéitgg§u':*’i 5-‘:.'=‘eir§‘g Hm M,“ C. was maponr :5 mm-.-4:sr—.ra::+ FDR c:-Fncmx. USE arm’ ============================================= ./texts/FBIZodiac6/248.txt ======= _FBI NEH_Tfl§K f9A‘H?-9#33]}RBUTIHE! . fE'~U“....THE.~“5~ “W cm ASH W U. M~*—M '. _. _,_. 'r"'_" _ *=..=*b;:_ .\_ A _ Q ; 1 a r ~- ' urn f-;J-g.-if 2.!-_— 551; Eisfiwu 'c:'5-M MI 51399 ' RR gDEflWB§FH1Nflmmu -- ;._.., .--_-_.—, mu. as FE.I="1’n' 3535? 2332345 ZINY EEEEE R zozarmz nun: go . war.‘ _1=n F31 firm-muezee :5u1—:i4~r-<9=.a3_1 mus} TU wE%§C{3E F31 1]NFDi!RDUTIflEf BT _ ur¢I;Lns ,;E_;-_I=_ I D A_RHE3- mo |I|fl.NGEREI' 5 CITE: ff3fi?Off '3I.Ja.|EcT= "Litmus; Mn,» zaumc aL€‘>’ L W ============================================= ./texts/FBIZodiac6/249.txt ======= Wu -“AGE THU DE F3-IHE-I 'C|\.-~'_'|? UMIZL.-5.3 E 5”» T_ D CGHPDSETE BE-$.33 A srtxaiys RESE?‘-|B~L2':t_~lCE T -HJHEU i=u_12r|=IE.z-r:uEs::Rz-5E-:I A5 amen: .-“ALE, D39.‘-n':r:‘-4 SGCEAL. sscua; ' 3-!'fl'!§§'-' CI F *2 ECG"-R‘E:l" jg l3h!I‘v'ERSIT‘a‘ uF Ln £23555 Iuwu EH 1-5:33.‘:-«:15 Hm N-II cenrncr -dun-\ -.-.-» ....»u_,- ._... ._-__a-vv\.. . '-i4'1T§-1‘$INIZE THAT TIME. -" - ._ .-:-:- AT NEH YJRKS HE?!‘ TURKS UI§SEI"'1IN-.fl.TE IH|:I.}EH.I1T.iC|W =RanARDTH'é—ra APF'R'.CIF-’R.I.fi.TE Lma Em‘-CIRC‘EmENi‘ AGENCIES. I -R:U'C_' -HILHAUKEE -_ ARHEE -nND" [JAN-552335. ET - I ~1='t2I-:'J-En-1" -m4.mz—'.=.=_=- .«:*-=~'.;=: - - -4 f_*¥5''L|’N? VEFEHUH; NE|.d_ ‘fflliéi-'.. _. . 3.: 5:»:- ============================================= ./texts/FBIZodiac6/250.txt ======= {W C" \- REPORT _ , 3 ofthe _ _~.-=2‘ _ “ .._.I - -'_- . . ,..=-*.-.°=-=t"*-m'* 311% irwmnm _ . urAsnun:‘roH; n._c.':i.. -._-can _ “We .““*'-“‘.‘."'f“'?..3!:.-'F"."§!'-.. '-'.I _. '. J - ::=.=as%»=:& 2&2; ':;-as. % [ 1 FBIFLEMO _ ' - _u.;~r.-*—_~%_.. . ; . ' {W-'~-J2¢~=*"iéi _Hq naa_sA:.|:='s 1:onr6RnwmH"- v:I:c*13:r._m - __ _—-amw-_cE.-3:13;. zuswxruwloatag .1‘: .1_'hHI!=1‘-i5i‘ih*;-95 «mu 5 ma‘-1sI_sa";hii:1nq“ E1-ac _'I-icbonal-\j’i-. :_ nmma. an .5’-e_-nu. . 3134_1»_:_w.tant1gn “I: ' "_:ugJ.muj:;;e --.1-:-u'“'1'.":‘ . "1... If‘-5-l--"""-;*1IUl-?'-I Mnmrku_,' §w. ' '_ 1-l'z1I*1tnfl"_?.-'bin|Lr1m;*tz-nu’-‘ ’_ ' 5aaaffi'i¢=* -.2 lilGRl“flfls!l='?IEK l.‘.Hll1l.'fl!|2l'.'IIGfl'3'.'E‘HlH 3.“?-F'~..‘5!!1.*-,1 ' " ' " . Nd’. *1 .- .t...v.r*+'~_i'=.:!'7i..... ' Q)—'n'fi£1:a I9-49'9'1'1'l - - ‘ mdsteie I65 1-1‘! Page 1 a-.uLtoc-Hg IGPNN ============================================= ./texts/FBIZodiac6/251.txt ======= d5- '. - ' ' }r:i_:H;: ';iheéf_"'af fiapé} he-'a1t"i-ng he _ — - _ _. _ - __ ha'ngi-printed Z_].e1:§:at‘_'[front and back}. heafiraryiga-3'. "d%q.r-tI_1§.-.:¥._is_the_ :oiai_g;_.,.' _' . , Q6 ' _- Aummpanyinq prim-;a;:1 '-¢:_ut':::utu.;=,:nt1'r.1erI_' ‘I _ .. *CE~IIEr'_ESE _i-:-zmmca -. __ - . .h _-Jkccc-uétpanirling ]-fir.-i1'£t.-El-1:_-CL1-1'-. bagniginlxig . _.j __ "'1fhg'e C:|_'I.'5._§_L'&;so.._'_31:>|:flf.i1_I::-:-J-_+"' _ =. -. - - é._lccompa' -I"I.3¢r.-i.:I1v:_:;'-1:I;I'1]'-I.1.‘.fl.-Q .cut oLiLI;pgr'in§1'i33'a' '_‘Hnn}I'._CI1£.I1eze b-e2_l.1ave'.. exalt. §::Inra1i1a1_f,_i_u:§n_: ;_-._'f"_.- -. _ -__-1-31"-'t'C'J.;g::_t'L;‘t'1'Igh.E2l5’ii:i!r1-5.-"13:-at {L-te:I_!v:'.i.,'fi_ I._a1-.-mt Pile}. _ Rzpxnaantative mar.-iez__-' :_:«E_ the bog; q_L:1de_d:-._t.p';.thi.a--f_1§|.q-E t‘-c_u_:: future rafarén _ - .'|>Iu'_-Ila--a_¢ta1-1;u:trIr'::-I-; -,-infiant-ed-firiting. "_-\___ Hinge _£au.n:i- an Q1-..throI.1-911' QE—.fh1ch'IH'al:1r_1__b-a ' - df,et;_e_::jm.i.ninq'. the !lfil.}I‘¢G these" _BpIEiEil1rE|'_'Ls _.-Pagcé , - . — - - ._ ;" ';."'5 3U31L'?fl_E|9 D LL . .' _ " .' . 7 ============================================= ./texts/FBIZodiac6/252.txt ======= ../_:I;_‘£ minim? __ -_'- _ _ " 'nivEs'm:Anun ' " wA§IIIHG1ngI,__n. c._ 29535 1:1_‘fi._....-' Iu_c.|nun.uu-M-ot.£nnt4£I4I&' 'FB1_E=L$ND.In-aunts" nhaiwoi iii 1:93; _I! :1: 1n! Bahnvinwal Balance Invtttigntlvg Support ' W-'='-..1=2r.: -- Thik ¢IB.m1uIJ'.i.0\'-fl bl-5 I:-2-an math M-‘H21 that u:'-dllrlull-unding that She -Hfidelltzk in conmclfia with an ufilciss - 1+ '-' " in-1'Ia!!:Lifi.nEiDu at up 1;.'I‘ia:inn1 manta: and t_h4_t'tbv Ldlomtanrga:-' w_i1E he uuled. for orricigl pIu|)¢nl!EI oqL_-.-, relax-ad. In UI-3 stlvu-tag-u11n_n car a Quhpgquent nnn:_;:_ua] pwpgggunrl. uumnzaliun :nn.rI¢t bq grantnfi for J-‘he nag or rm; Lahumlary Iupod :u1 cnnnmsunn with a :1-algeuc-1:-;ad:n|r. . - . _ . - 22 mngsggxutia in ' .!.U=|3* 549 ============================================= ./texts/FBIZodiac6/253.txt ======= 5 ::..‘ __ I 1?:-3': £'1v:s'$-éginiing 'yfiu _<':It_l3':n_' '_ Rnuult at l5n;mI.1.I1-It_J.nq:{_I:'.-'. , ' ' _ _ flu o:b.Lgina1 '£od.im'.-' cane‘ i.n1raJ_.v-u_ ' ' ' - letter: and er}-ptngraal IEIIJLII5. to :Iu:|:\d:e:i'in'I:ha:" Sacrlmcnta - ‘S-:|.n Fruliao arm in the 1I.tl__=_ 1_9EE|'fl _ :_E.-I.:!.'1}' 191ra'n.,‘- we *-median.-2 can Iu-_.ru_-at " ' ,_mfu-..;1_t._g_ __d.fi,t{.\- _. ,_ .--..-'_'_W__ :- _ - "Qi E - mi-I 'typ¢__gt lnttoxn -'I.I1d':'::.'}rpta-qrnna §.nI|'a1V'Iui'J.I1 ":11 au&;q1.-fihraiugh.-as _ Elton. 2'1tt'l'.E:L¢1d.." _ §i3féi££'é:' '_' spenimnnqz;-id'qei'§§&p _ -' _ _ _ ifltln filth \m.I'1.a.1:ItI.= In -nulzli -I i':rjr]:3i:n':xa'tIfl¢—_- hiatt-Ir of 1:J_uI Alp-habat .LI_:spJ.nnn_¢i_I=jr;:I:InId‘¢1;'_!n1:II=__ - -lyubalt to links the unsung: unrnliilibli which occur more rrqqnwntly in-th'1':_'Kng_____ 1:.“ half: nqro any cipharjzaxt Isqui.vI.1_Ig:1_t.. .l __ _':l'Ii.EI:I!'I;.‘.l'I'.|,._H'.I.I'.|.I:I ' _ - _ _‘. it B. . in-:._ C l'I.'3 v. :| 4'- 5 '¢_ .1 ii +@_1"F|_&[\-1:”. Flat 3 Bil-I2iIfll1 II LI. ============================================= ./texts/FBIZodiac6/254.txt ======= 3“:- I“. - . -‘Int ct:-fptbqruplniu in 5],;-u::i.'n:1:I ,. Q2IndQ61:lth¢u:nu.th-nnnund£.nt:haorig1nn1.-- - “ION-HE‘ CI-1P-‘Mr: ‘hath 1ah:c'er1g'£nn1;_u£.phnrt'.urI: and" '>:_; -" _ its dinrjrptinn-hart h-nun pu.b1.tahud."-~; l;ln1II‘ru.'; than -I _ " . follauing dlfiarnnuis should . __.__ --cramp:-grant in the :uhn1ttod'a'p=uu1n:n':.: ind. I;:ha- urrptpqr aul:.hn.r'9d -1:5! - ‘ r :1: 1.; ., a édyplitl 't‘aL'tuu.n§].u'_- I-1.'I."'. per‘ .1.~:u.‘. . no ‘cw.-1-ptogruu ** ._'-as :mmu;lF.1,._i ,-lb 1‘: P“_ I°_.! .. _' . _ '_ . d-tc:|:3;p':.1..nn_ up-‘fl tp-¢u'.*.1hun' '3 Q1 _ ' - £1311:-ii. ‘Earl:-ltd partiuns of izhi“-'p1I3.i':1:.t:t"h:'-In" _.i:Ovl.1-‘IH’fl'..Ids that air: - "mm 111$: ran ' " :fi”run=zn-:1 _ __*:_nnif«-i&.¥_gn- "p fan “fin mm !i7i$u’l"fi'.H -I.IIfi' _ Ii.’ an-'1" ~ rmamnwnnnnzsn-magma nun n::n-mums Hm: anus -.1-an srrcwz. I: _«gg_n.:.'. Eng: 3 BI:-12-E-D-31 I: 1.1. ============================================= ./texts/FBIZodiac6/255.txt ======= THE IfliE-QEE1‘];_id11~_£;f- Q1 i'.12I._ID1.1g'h Q6 1-rl:i.11 furnished with the fingerprint raport. The results of the linguistics exasdnatiun will be furnisfied 7' separately. Representative photographs of Q1 through Q5 are retained, - Page i _ Efl42fifl31 D'LL ============================================= ./texts/FBIZodiac6/256.txt ======= -'i:Tx’. ;~.-.:1- 1-, If .- ;sd5_j_ _ ============================================= ./texts/FBIZodiac6/257.txt ======= gfigawvg =--er . __’$__,h\.§.;_3_$§ ============================================= ./texts/FBIZodiac6/258.txt ======= ~'.._ I :32! = . ‘ Cfififiafr 3' was lam. 10-assmat _-5; 3 I - ’ ' ' ' FIIJEIIM _au’nmu "or mvisrlcnnun -_ %. ._ I':I'I'I-‘-Ifi. ._ __ ~_,.v__.__._ - .._: t I. oi-the _ I. ::I _- . ; I'm£uI;r|us:npn|HI,s:cHpn ' gn£m|r:c.gnpu_p:v|s|on YDLIR FILE.-‘ F0. 9!." $1!-:15 $$1 H’? ’ . ' ' -I ’-- 3—:I'fij9I'91- I ' ' ’ FBI FI1-E ?-’O- - 9-4:99:11 . ., . ' . . . '. .' 3.-_,' LATENT CASE NO. 3-153;; - . ' --I . _i ,-_':.l_ -: _ 5-"I-G. til -. _-';:i?'§}:'.'-"!li§*3|t . _ ' 'l'.\.fifI‘flK‘ My 0 3-_-I-bl": “.tn't_'uut;'-5-:i. I '_ ‘ mmwa-Tints Rig. H4:--me;1n_*:ac_:-i'ntIa'-a - -- am '1néfi%E'-iigfiuv Jam Jdnntiti tiaign ..-mas of-Hmtad. _r _ ‘ _ "' __ I .1 .,3.~_». ....3\3-_-- ._ Hm-to-giraphn or than praviuualy ‘reported Infant print» in ‘ :_ thfis ears: are onxglomrd. - " " d I . "7"" mm Em“ W; ’1'I-‘-'8 Rayon? as Funrvxamfio ma E|FF|'C‘I'.="|L Lesa orw_.',r ~ ============================================= ./texts/FBIZodiac6/259.txt ======= |'}F'ER}%T4jR KJIS FEDERAL El|_'|fi'E,u!.U CIF INVESTIGATION PAGE 1. LATENT FINGERPRIMT SE-Cfiim mum SHEET J’ REF: |_';].E5|-],':|E F3I.FILE NU-L-= 1=HW?hl LATENT CASE N02 AFIUDHE L.-i.Bc-fi.nT-::-Fur NU-1 '\- REFERENCE I-10: - “IA-EC-1533.1 L3) REEGEDEI}-'-nu-1 rJE-27.~=1J. :_<_.:_s fi.‘E-{I-_II'U'EI»‘=_':-_—._..: na.-2?-cu. E:.JfGII DICTATED 3133. 1-43 _ %>**-:*¢g-.*:;~, ’’2_\: —~‘ ============================================= ./texts/FBIZodiac6/260.txt ======= .31,-__,-‘ x QPERATUE KJG FEDEREL BUREEU OF INVE3TIGhTIQN Ffififi 1 LETEHT FINGEHFHINT EECTIUN WORK SHEET REF# DTEHUEE FBI FILE ND..~: 9-H9911 LATENT CASE NO: h—TUQ42 \ L.J.E§C|H&TUR3{ Nu:-.: REFERENCE Nu: 9-63-{P} RECORDED . . . . . .: D1-2&1.-91 KJG RECEEVED5, . . . . .: c-1—2u_91 EXAMINATION 1'|‘;':fi b1U.. E?IflEfiCE NOTED Bf: - QNSHEH TO-...:'3hG, SnCRhHEHTfl E'.E.....-....-...:EE:-43-xL!.~::.;. ' -- ~ E}(TI3-ETIDI-L . - - - __ fiDMHUNIEATIOFt TELETIPE 01-23-91 EZULM RE-:21 B'1'-.: .!Lt:-Dazssl-:5 u- .-uue_ {:0-P}: Tl}.-. ,f'I":"“ ASSEIC. nzfnos: SEE-:IM'.E|I'l,5....: REQUEST TD PRU"-.I‘E{IE PHQTDGRAPHS DE‘ ALI, LATEHTS I:-E'.r5J;,c-1=E:I:u 1:: . THIS. CASE REQUEST TO SEHEEH THE LATENT PRIN?S DE¥ELG?E9 THROUGH THE ALSH AND HULF RESULT QF EXRHINRTIOH: —- rfarfir { AJJLi#Ef_ Z; fflwim;t Ea} 3%:-T. M , fl,;_g,,q_1, ",§**«J 3; §M€xU.ML(33 EXAMIMMIGN COMPLETED 3/ =74 J95} _ DIETATED 31"-9-412$-"'[ ============================================= ./texts/FBIZodiac6/261.txt ======= |'. ,L: .. , . J H JPERATCIR ms FEDERAL. BURERU -cur‘ IHYESTIGATE-SIN ' PAGE 1 - ~ LATENT FIHGERPEINT SECTIUE-I woes: saw? E55,»: o123?43 TE-I FILE HG-.-.: 9—il991? LATENT CASE NO: A—1{}|ZI1l2 .Aac:-n:,1°oEt1r z-m.: - F:EFEHE!_Jt.‘.E NEI: 9—6a.'LP) IEGURDED . . . . ..: GT-15-91 KJG REcEI'.r:a:.....: 01-15-91 zxnnmarxuu B'I:—'1uqU ':E:}{PED1_TE_ _ TELEPHONE Afiswafi -zvrnznca NOTED Br: ,,__—-——"'j'““—-———_____ INSHEH TU.4..= SAC, SACRAMENTO ::E......_._..._..:z-qqxm; ' ' __ ExTCI_fi=!='-Iflfi _ _ . EOHHUHICETIDN: TELETIFE G1-1H-91 Cfififi RED BYf.: ADDRESSEE :0? 1: ‘ED. . '. -—-- assac fiEr NUS; u51L; i?EC.IIH'ENS....: NAMED ans? CT: -9’ J I flax jg” 3»; IESEJLT or ExAi1I"Na'rIo:»:: mam —~ UM’ W “'39” “*“é’“““ M 54 33¢ % ——— !'Je»."?i jw £J&’v(f‘m£p‘9‘#Gp3 ’“""““"fi5"’%.w¢, -.-«.| Emnlnmxou cunnsn-:;:u if S»! lr=?LJ DICTATED 5J’.2«JJf°:,I S D "":*“: . .- : ============================================= ./texts/FBIZodiac6/262.txt ======= 3q‘!m.;,LQ\ 1::-‘T 1:.‘ f?‘”%:\;; “'3. 1? 57 \ “r/‘3f:"i, - ifiwi‘ QLM, W:;:¢w W %W—* fifixgg ~ ' K; v“ %/fie, ============================================= ./texts/FBIZodiac6/263.txt ======= 053.1 FIFII -112129 ‘E ER RUE‘.-‘u'FB 1 “E - _ x 'Fx " E DE FE-I3‘: #[-"EICIT o2a *q_ zmn uuuuu 553 .;L;_. «g; as: ._.;_ 2 z223a9z JAH~ =_ i. — _ -- —'-:_=- _ in X (3 C3_ E '\._ I “E . FBI IDEHTIFICATIEIN nrvzsrmr, LATENT F-‘IHGEHPRIHT SECTIGN. _II'‘‘-\._\ a LI;fil‘_.,;3i.FBJEI2'I'.'|."'EIElF_.|iI’;_I_nJ(_I_: -§JL?'|3J!TI£ZIN nu: sacannenw. RE SACRAMENTO TELETT?E TD THE nmnecran. DATED . RE-QUEST 1'-B THE FBI IDENTIFICATION IJIUI SIEIH; LATENT s=zuc:Estr.21'MT's.EcIIm+: THE L.-KTERT FIHEERPRTNT SECTIEIN IS REQUESTED TE! PR5? DE. Jr SAtRiHEHTD iITH rnurasanpus as iLL LATENT FEHEERPRIHTS ;§fELflPED I DURING THE ZDDIAC IN1I'ESTIG.|'l.TIl'.‘.Np LATENT CASE NUHHER A-19542. %__‘_‘_l/_;_” THE LfiTENT FIRGERPRINT SECTIDN I5 FURTHER fienuesrsa TD E fipfiiég fig S.EMi_C}i THE LATENT PRINTS DE‘.-'ELI:II=ED 1N"FHE :nr:-Inc CASE THROUGH THE -an-ck ‘ask.-; - - ,: :¢ 0]JLJ(0|°!]] I ============================================= ./texts/FBIZodiac6/264.txt ======= PAGE THU BE FBISC U00? UNCLAS AUTGHATEB IDEMTIFICLTIUN SYSTEH AEHLFHE HUTDHATED LATENT SYSTE§S MDDEL AND HhTIDHAL UNIDENTIFIED LATENT FILE. SAERJHEHTU 13 NET AHhRE'DF THE REQUESTED 5EAHfiH A5 PRE¥IDUSL¥ EEEH CBNBUCTEE, “%HE-@Hfi¥flfi§iPfiS;DF LiTEHT PRINTS DN-FELE HITH,IHE §aEMTiFiénIinN nzvréinn IRE seine édusur AT ffie nEqu£sT'nF EHE. HVILLEQU ClLIEDRNIi PDLICE fiEF1kTM£flT; HHB INTEHfl$-TD RQN THE "§EIHT§.flSElREH rnnnunn THE cAL:snnn:;"5Epna1near dF.Jus1Ic2 hQTflHifE§EtITEHT PRINTS SYSTEfla SACRAHENTD APEREEIAIES THE L§}éM? FIHGERPRINI SEETIflH'5 nzunpr RE$PfiN$E TB THE cunwamisnfi REDUESTEQ IX iEFEiEMCEU TELETT?E- 3? — qooor. Hung ============================================= ./texts/FBIZodiac6/265.txt ======= :_ TD DIRECEDQ FBI [9-fi?9l1%fE$U?IfiEf kw C|'.LF$' H2! iI].|'.!1-‘I EE FSIEC E9332 fi1fiE§3§ I112 $_F'<.klJ JU Fl 1*§L93‘:'JE .1.-10:‘ *3]. F9‘, F‘€|II'_S;!.I.'.!U.'."*!E'H_,'[':.| I-9-63} H31 51' "- {JNCLRS I H ?' nazneti lsi-an..;i?;:,¢4aex<3us CITE: "'3-'i".=.'3'.a0:r 91/ P353: ‘ IEIENTI'Fv'IChTIE.'|l-.! DT\|'1S3:J:'-J; LATE?-ET FINEBERPREHT SEETICJM. i“--. RSUEJECT 1'UgJ—.,’-‘-£.T.-‘;‘T:‘C7’.-J"§T[fJ?5I|_F 3I'A.C:fiu”iE9-3‘s'U- ‘an ' x“‘‘‘-"—“*‘’ Q‘ 35 [{5'.EH'FEF§':-fiTI!'J:"? DLVISIUN REPS?-T; '21:’-'lTF.U AUG: 3.5; 196?; "H Lnéht use +aI.;.~'.ra.E»t n-xrmqz. - i:EI.'.wL1f:S{‘ 9:: THE FE-E rp*=.nTr.=:£AT1c~, -:3-zvzsren, L:-.":'EHT . _=3g¢s°a?E:~T 'sa(_‘,TJ.-3M_: CEQ <5 tg"]{e we LAIEHT FIN‘-SFRPEIHT SECTTUN ‘IS REQUESEEEB ‘EU EKPECIITIIZIU :_'r _ saunas L:‘n?ENT rapm; QEVELUPEQ an uz Mm Q3 !.éITH IHE %&§hD_¥____ ' :@F:McEaP£rNTs CI96-FILE 1:4 ‘ra-:5 lI{IENTEFII2s'.*.T[Cl£\! DEYISIDH CI? 575-’ E X. 5: cu-_..,..._c. 5 c--. - —«=“R~ M"‘D”‘ ,2 - . éggfiy ' ' 9&1 ' . ============================================= ./texts/FBIZodiac6/266.txt ======= - Tun-{T-;. .__ .- .v-- . 1‘==r1vaL:jI-=LLasaTeuLzce _ “mi-3 ._ it . _ ?i-fié T'=fCI DE‘ FETQSC ('|C|f|Z UNCLAS - 5.472 I_T:= =.=T:;*.L|:‘1'-PRU‘-‘E935 -THE SAERAMEHTU JFF-'IC,=_-u 5-‘Z Atéil: -:53» a’-IR‘?-. SEC'1§*-1'5‘ 5."-‘E? T-"'5£91} P-'-335.5 UF -5! LET_T5k___sEm- av SLEEIJE-€T TI] 3-; was :2,a=«u:1scn E3u.;«nIME_A. _"-‘THE'LATEf‘~."|'...;E_JI_5H}E1F‘RIi"iT Sé{ZTI.D:'U. IS FUKFHER EEQUES-TED _TD_ __ cnn'1Tu‘a%E-F1nsE29s21uTs T4175»: .a1LL- ETi§E£ L1’-‘=TEJ~!!_'.F'_P.I2-iTE._ EIEVEL-BPEfl _E|UF{iN{§ THE EQUINE EH‘-a'ESTIIS!.L.TI_fl!*;, LATENT {ASE NUHFSER A4 - -T743‘-3!-3._..IJ:|§__-_]'I!*|FJI|5?.‘.?"!s'iI.TE€3i‘§ SF THE IE}EM'fI.FEE]a'A.TIEl9w‘ BEVESISH; THE ‘HALL-.E'J3;T"'i;n, PCILICE T:-EFT. H223 REDPENEI} ITS KMVESTHATEUN UF CAPTIENED suaggu. .|'l SUSPECT,-HAS ‘BEEN UE’I!ELI2IF‘E|2I;- J.'3I:I_'v15.Eq __T':-us--5-:n':' rt HISTUET cl? 3:: nI=T'-2'-.'-«isas !n|HI'|.'.H SPAN a} f~!U£'!BER arrvenas. aur waive ceases IN 1959. IET-.'%.'.ESTI5_§I.'|'EUH H11-3' a=1..n~:En-zT»: 1-‘HF. n.:ca,n.§s T-T._- RE'fi:1R[2IE?~h'é n,:-av FUETHEE UEVELDFHENTS IN THIS NATTER. fiRHED AND BANGEPBUS. ET #5552. F-JNNEWI " 5?? --15 i_2URn'-‘.':'.'u'?L‘f QESEDENG 'I!e— WHERE HE HAS Livscg ============================================= ./texts/FBIZodiac6/268.txt ======= ============================================= ./texts/FBIZodiac6/269.txt ======= ============================================= ./texts/FBIZodiac6/270.txt ======= ALSA3 7' flggégg DATE 3% NKM_E ENGODED:2\;13J”1f& CASE’ NUMBER:I_,g_i|: [:5 |-o- u ailgfg Fan-M".-1 ’4 5..:.: 6% 7. ;8» 910 Far fl- 3 ¢ _ FPGLl_,,i- I... Hm LP‘.Li|I°:J| E! I: %i L1; = F'''|'5¢H'l+%_J1_JM}!r§'£P£§_a-~T!| : 1 L__II-L,ILiLJI__'2“: SEX E]- RAcEEfl_ Ann Lac L__mJ__I‘7:_I_JL.J IJ !T1F”l—H”l‘%£—L—§E_' FOB E1: qgr Afifiiflm %kfij HGT It 7-: 1 W57 i * _Tj . ' HLIH L-_ _ 30 fik EYES E 3 9/ W SHT E ============================================= ./texts/FBIZodiac6/271.txt ======= ALSA3' ww we: { DATE 40 _ . _ ?’ NAMEI. i__ W _% ENCODED:2«~]i5flH CASE‘ NUMBER:L3_;if o [.9 tr ;J_§n 3| FGR a1“@2z_3 4 -5? 6“ 7-_3 9'10 put A 5 t , ,_ _M___ fiP¢Llié§ IHQJPQHQFI IILLJEIHEIJEI Eil o[?w}:37L;JL: H_I|TT?F*f Lac la» {lit %p_|f ! LJIJ H 1?; g H h In - 3-0 .5\1?5'|fi'k ============================================= ./texts/FBIZodiac6/272.txt ======= ALSA3 ~ %¥ :46“. 1 DATE - . («iv NAM_E:. :4/*U_ ENCODED:;~13"1{¥’ - CASE NUMBER:|Ai .* 0 0 U ‘-L!.|£:|*1* Fan‘ L1“------—2-,3 '4 5:: 6_._ 7. 1 8 '9 10 Pl-'tT A I3 C» -_ H..____, rpcL1;W;"fiI”flt"r‘.6”“Ejr;vT=HI ii Ia 3% F'PGljl_ ; n 1 mm ma:;_1Lg_J: .*wr*%:“r““=.“r3F"%‘ W3-x. . '. sax age-=-@ Ami LOG I543 L :2 [TV FOB L 751 AGE L‘-I a ~|3-‘-5'? HGT i *1 5 Wfifiw —| ; _ HAIR J“ wy EYES E . _ SHT E f j..—.-...—v-..-.¢—...-. 1. ..J ._| ============================================= ./texts/FBIZodiac6/273.txt ======= DATE ,/5;, I -' I‘~U5uM,E;. ¥o_’if"_ EMcoDED:ggm CASE NUMBER:|x‘H .r aft-= **-1.1--‘1#~=~" Fan’ .«..3 4 -5.1.‘ 7" .: 3' '9' 10 PET ' (91 I3 0-» ' EPGI, I,C§J£_mL.,JIr!:.IU’:n;J;_¢iJ 7| ii FPGH_l_:__‘M_1L.| gas-0 We ia-JBII I if i|_ I . . . . ,U_ SEX @- nAc£[_‘@ AGH Lficl-'=!AJI£H i“1Il!LJ|:”1.I.%_+i_,;_' FOB T" AGE I4 0 -Pwf HGT __ ‘I I 7 * wart __ .| _: _ _ }Dv”'l§:.,_x HAIR E:|:| ~..\‘ EYESCIE . H SH? 11:1 ============================================= ./texts/FBIZodiac6/274.txt ======= ALSA3 WEE _ b DATE % NAM_E:. V‘ __ ENCODED:-gt-$9.1 - CASE NUMBER:l.-HQ: .9; ¢?q:;;.!o;:.: ' ran" ..._3 '4 GM 7- _ 8 9% 10 PM 3: f F 6 - '_.m_”._.__w,_ fF'cL_Cl:$‘EE[EEEiTPi"F] 5 = E7517 F'P¢IfI_LJ%} fr‘PIaJl_fi¢ We Lawn i I: Cu fl"'3EiI Sax @- nncafl Am: 2 : L Lac 1~<'_A|{ I H I I: ll 1| ‘Ila %-_n_e_ P03 2 V1‘! 555 Efiéfh / HGT £’:”—”]- . X WET L; 4 :— -1”? Dwflfiaxfi‘ HAIR EV’ 3 211‘ 9/ EYES I , SHIT I ============================================= ./texts/FBIZodiac6/275.txt ======= ALSA3 * guggéfifi DATE NfiME* -’@L"’b .. “V % ENCODED.5% CASE NUN1BEB:L,4i|;fo.al;ja:-K!_0 7. FEB .1 ""~-2' 3 ' 4 7- __ 8 '9' 1C PHT Jl ~_ ' EPcLI:[fl.TJE:C[:.E3L‘“T'"'*I_J T"”I 42 :2 1 F'Pl3Ifl_¢__L£!..§_£)_|| I ! EL 4?‘ 1 I i; I :i__L_.|I__L SEX fir - nnclafig Ann :2 L00 l<"_.'*.r‘?'f I 1| ll IE I; |: 5! f_ |__ r_. ============================================= ./texts/FBIZodiac6/276.txt ======= ALSA3 9% NAM_E ENcoDED:,:J.xW»." . CASE-NUMBER:[71”i| fa .3 at ;|_g .c:]g__| 1=an- _1 ¥___3 '4 PET 1-? u F'PcH_f;iE]LN| i! 1 sex [11 nA.cE@ Ami 5 6 FPGI-1_LLG_|T”7 H :_,_1 E E I 1 1_,; ’ irj Lac IcL4JI iill |: J[[____H—_Iji !:J,E! ============================================= ./texts/FBIZodiac6/277.txt ======= ALSA3 W DATE 99 /,4: NAM_E:__,:" ¢P~lCODED:A'~‘_a’tP\‘~\.i? ; CASELI NUMBER:lEU [J A :ri*|__H__,n3“:—-a 2&%::? {.9- FGR '4 SW 7_ _ 3 -9- 10 LMIJ-i||.|1%L_J i%!__- I ! L;L_.J‘I:L L_§|_,_.E'L_l_:-'|_i 5:): mil nA.cE|E man H Let: W?! ,_I% lél i.Jl.l|I J H I if I I! L"]i_;f FOB S AGE LEj_- 5 HGT _m — ‘HGT - i HAIR EYES SHIT E _!.4:. H7: I ============================================= ./texts/FBIZodiac6/278.txt ======= CASE. N_UMBEFi:fx1§ : ana =4.-Lsmlo 1=m-':- _1--2- 3 ‘4 _5~ S T__8. PHT Q “N L M" fl l=PcLCII[L1. & .% ! ii i I‘; ' FPcH§&DJ llil ! ” “:1; sex E. nae: AOII LDC . L# E. EH3 ‘,1 FOB AGE ' HET ‘HGT : ~EF % _ § J . HAHI J#[4mJ_J ' aufigj . 3 I EvEsLJ;I: - U?i 537 C:j:' I H IiLJ7!i H Lip; ============================================= ./texts/FBIZodiac6/279.txt ======= CASE. N.lJMBEFi:I;f1IL1. aka 9-Hal .1: I ~ Fan '4 B____ 7- __ 8- '9' 10 T — mw“: :]:::cI.L.a.J‘?"I I I I I ILJ II II I II L,_II_"I:]_i }'__- r-'|:cHIa.Ir.II I_jL_j"'II I II:'_;I II L.JL_ |L|..JLI__I-* 551': HA1.-.E@ AGIII L_; I LDC |_-I-:.HIT III LTTI I r§_I I I IL, I! IJLLI POE Q: AGE L'LID_ "E HGT I"T’!’“—I’7—I .. WET I’"‘I_, — F1 E Q.-"V:3._ HAIR CS3 % ' 3" -,i‘9‘U;/ EYESHII I » SI-IT HI. ============================================= ./texts/FBIZodiac6/280.txt ======= ALSA3 (M ’“iaW DATE ¢ rmwe.-L ~j‘=°"°'_ ENCODED:3.~}f5-‘ME . CASE NUrxf"BER:m il ;ra'r.:':«;'¥:-..-}:.1,m:»_| FGR‘ _I __ _ 3 ' 4 6“ 7'. 8 '9 10 PR1“ H ‘I __ Fl"-cI._[§flE[_l_1T~!_"I_*T"il ll il I is I _|_i I'="PcHJ_lg5|EL_iMJ3_L~ 5' '___ sax" . nncagg AGH 4 —...;—..-....._I Lac FC1__fi[ I if IL-7? il il Vii |: | |= ' l.n4—\_n_IID:j'jj'- FOB 1 AGE u1Ls‘— HT _ HGT ' E ‘HGT H %‘i“"‘: _ .35. $\n\ HAIRI -;}«w/ E‘rESDIj - S-HT :g"T"—_ . ============================================= ./texts/FBIZodiac6/281.txt ======= -PH‘! P ~ _ __ ':%=|=-<:|-_15%_gJL_;r I I! i 11 1?: il I ,1 ALSA3 fa“ r€“’;,%”53' { -- W DATE " XE NAME: 1- _ ENCODED:Eg’-Mrs‘ CASE NUMBEFi:.|;4iL;;c:_l.a2|~§= a1..l.| :12 I ran. :3 ' 4 Leg 7) -3 '9 1 J E FPGl.L:..l LW_L iI"T‘II‘“T"] ”7T'”I""‘!F‘T”‘”£‘ J J_E H §_ tr SEX mace Ann ‘L ,2 j LOG E:=HLi1|%éLT_i !i!I!~_j1.I¢.r;_ FOB E nae I’s*§a -15%; HGT _ 1 _ war -; L 3* I-nun L, ' 30 WKW‘ Evasj - '5 SHIT 1'. 3 ============================================= ./texts/FBIZodiac6/282.txt ======= ALSA3 DATE . U ’--’ N.AME; ENCODED:' ‘ CA8? NUMBEF{:IEjJr' 0 o HIETFJE pan - "I 3 ' 4 '6___ TI -8 9 1* -PR1‘ IL ~_ m_W__ FPcI.L;g,-.LL% I I JFII I III I :|i" '1=PG'H_'__L2C_57 I I? I ; 31 I II I II I rI:I”"II_T'7I— sex E] RAGEE} _ Ami Lac ELI-EH I I; I II jI_J.I% II II I. I! FOB I__ . AGE IEK--'15" Hm‘ E" WGTI I ' - i I I-mini U \ EYES '"' 7" 23¢‘ U./I surr I J 'l.._[r_,,, ============================================= ./texts/FBIZodiac6/283.txt ======= ALSA3 (6614; (3 DATE 3 _ % . 49-’ «at; NAM_E; ENcoDED:;;5‘”w1 . CASE. NUMBEF::_x:1- r.f.::«”|«==|*~t -1-L.T':*.~.-I '4 _5+ 5 7_ 3 -91c PET _w¢ ___;fl!Hfinjh_;_:;_.L__~J£fi:E Fan _-1 FPGL:|:D' .4 1?“: I: %§_£:'1‘-_l_;o.‘=g r'pcH%!_JJ FW; %T aw. IEEEEE -I ~< P‘ ~r'»"‘°$ I sax Q. »\:r.3.‘«‘,D.}" nncefi Aall I ] LOG ILJ-afil :11 L Ii Jl !‘1.F‘"Tj2—g_: __;:_* HGT J — J war 1 % — 1 1 w HAIR i J 3» 1* - E"lES[__J_ -NU/H I ============================================= ./texts/FBIZodiac6/284.txt ======= CASE‘ NUMBEH:W Fan'.1-~w2,_3 '4 PFlT._H_ FPGLI FPGHEI: r. _-_'_',,_ 3:: E; 1u.cE@ nan [3 _ Loc uuflH II R H 1| i I1 I7: L1!’".[".1i:; POE E AGE HGT %- EJ IMGT g— | HAIR EYE$__ SHT EDIE: ============================================= ./texts/FBIZodiac6/285.txt ======= ALSA3 5‘ 3%»; J wk DATE L A NAM_E:_ ' ENCODED:a1‘~%S€-“Fifi”: CASE’ i\'lUMBEE={:g.,q; ,' 9'3] L}I.{..:.J nu PR1‘ __ FPGL L___i |_§_ FGFI _1 M 3 -4 5 7d .3 .9 1c F:-cHf‘“ I 1 E -JD sex _ $"£~"€J-l~§ nAcE@ non j Loc Iggfl VI 1 [ E . ET”! !I__l 1! L_|%__;_' Pan ::f AGE 3-5237? HGT i — | j wcrr — - J HAIR 3'3 T,“ J —.| EYES T; sun :—|—' ============================================= ./texts/FBIZodiac6/286.txt ======= ALSA3 egg? 5,1935 DATE . . ex. - Jfi NAMLE ENcoDEn:c;t-J3-Cs;I"*= CASE NUMBER:LAHr :2 0J*fi.1__| ,;g| Fan‘ -1 ""_~*~2 6‘ 7. ;_ 8-- 9 10 '4 PET __ »_ W . 1' :1‘ are; |_|_H-J - J F “I”; ‘L,._‘”“7i i“v:p_-.=.r.-fl FPc.u_%@3'J4 I « ll 1 |J_,J I:e;o"Er”i'fi 52): E- %Q=‘”?-G-‘.~""¢ nncagg AGH 3:1] ‘-09 |Ql\_L7J..J_El VT !I ll |I1__j? JWL; FOB I S, AGE EEE-éfg « HGT E I —{ ‘I we? i -1 ‘T’? -9’ yfijim. HAlFlI:|:C ' «fix Uy Evasw _ _ __ sun-r J ============================================= ./texts/FBIZodiac6/287.txt ======= ALSA3 W ééaw DATE NAM_E~_- __wm EMcoDED._.,_ % ~;:"" ~ CASE. NUMBER.-I,m run a '1} ;}.!.J M‘? FGR *4 .5: 6 7. 8L %9% 15 PR1‘ uni-Iflflnifi __" 1 L FP¢Ll __ 1 ii H I E JL£.L;Jj_I_%§ F'Pcl-If : 1 "b 522 fil x3“-*gv"§,3*“’{‘ nngcagg ADI! I 2 1 Lot: !"rf'.”U}L_| H 1. IE] ll IIJEI 3 III]! was F‘ g! AGE Hfi fits I-ic='r%_ — ‘ Wfi'|'il — -.3 _ ,}ofi°~‘ HAIRL _ 1 9% Eves: g i q _ sin K: g '_ - -4’!-. ============================================= ./texts/FBIZodiac6/288.txt ======= ALSA3 fig? #3/Egg, DATE NAM_E Encon-ED;M€L CASE. NUMBEF{:L/Hf .' ajggisp. _[.-.4; FGI-'I".'1 '4 5__ 7. 3- L9 10 par fl PL" ' FPCLI. I I 1% rllii I J-L.f“II _f_i .'-pea: L._._l HJIII-.I|IIQ!aIL.1,zs’7f"“T mm H r... . -‘=“'—..4-._C.. . .35’ sex" ‘$§q;&:§‘.‘a° nAcE@ Ami : j LOG 1u.»§!I I 11””: H__J :| F“: i J_-_:: I. !y.i_w=_,__ P03 |: AGE firm — HGT 13-U33 wt-1' H2 4“ L; _ gu “Q5. HAIRI llleypr EYESET % _ su1- I % ============================================= ./texts/FBIZodiac6/289.txt ======= ALSA3 we -I .5}. 2 I94“ N,é.M_E:__ j '_ ENCOEJEDQ M» “F9 CASE NUMBER.-lnll me» Q; n}'!l=~.! .-.-.12.! ' I=c'.I=I-- .--1 '4 s___d '7, 3. 9 10 PET - _1é:.- FP¢Ll— 1 _ . ' % EEII FP'C:I-IE; : s . _ . - ' ,% at qrg sax H. ‘We? nncafig: N3" Lot: FEEI 1 :1 I 3 H T” |: I r|__ POE —‘H_ AGE_ LE5: — it 9'1 ============================================= ./texts/FBIZodiac6/290.txt ======= ALSA3 ' J }= rIr)]l?7‘?___f:/7 _ 4“ DATE NAM_E-'_-_!L“’ %_ ENG0DED:;l=:§-?;T'&- CASE NUMBER: .,-ar W}; L; ..1L_!3.%3 FER‘ %1%-»-=+2L 3 ’4 .5: 5 'r 3 -9 10 PHT _ has-gt-fly J4“.- EPG-_L_I _-I lluiflj ILLJI !: I Ii F" ‘E W W‘? cm Fr] |"%'.’_ ; 3,9; ..e 5:: E $@4§}§ nncefi Am: I g ; l-¢¢ ICJJLLI 1| I W} |""W“1“|i I ELJ. lL...J,,_:l'a_;_'. P03 75/‘ AGE %5rT—§3$“ Hm‘ i:j“_‘—__M — 1 ‘lax :3“ it mun 319"‘ v,/_: E"fES_ g ‘~"” \ _ slrr j—|—g ============================================= ./texts/FBIZodiac6/291.txt ======= ALSA3 _. V gkfiflfig .~ 5.. §'._,¢ - %””é‘ DATE . 4:5 NAM,E EhIGODED',t;.g'.»Ex:/:6 - CASE NUMBEFi:l.,»<1i|1 om 4:; .4 .2 :1 FEB ,1 '4 T. i 8 '9' 113 PET #I—Il!_,-Ifiis; PL ' ' ' FF-cl. QJ-.JJ HV% i 5% "J |.% |'='|=rt':r'I<_#CJ"'1 ‘W Kai Qua i_L,j LL} L4-.4 . 3: 1‘ 5' sex Ml %‘Q“*’~=$‘-3 nae: A0“ E:I ' Lac IE1t_¥_I|‘”T‘1I El ! JH LJI 1: r%1a_: non Le AGE %=+[o —§-+4 HGT I }— WGT'Cj.3-1:1 9.9 J31 HAIR 3,._L_, 31' cw’ Evamjj . '\l'\- SIIIT CI. ============================================= ./texts/FBIZodiac6/292.txt ======= ALSA3 I .y %“E?§3I DATE NI5xM_E:; I W_ ENcoDED:;I~gI-—£sF“°- CASE NUMBERS./‘ii I D -'3 ‘-r ;,J_! ALIQ FI'.iH' ;..3 4 .5‘; 6__H 7.“ 8 '9‘ 10 PET A-‘III-Z« Ii-____,,_%:_ FPcL£_;l_l_L @¢JJMLUtfCCi: FIPGH‘-E354 I I W Lab.-!}:',J :44 IflI__J I_I:I L.,._C 4’ max. @- n.aI.cE@ Am: I I I-06 |T!Tl,_|_||”T7L II L_I[' II , . I! .f___I'i_;_' FOB AGE It:-5- ~+5_ HGT I -I I WET —- ; _ HAIRL 3”’ 0.1 2.‘If“ EYES I Q97/. I . SIIIT E 3,; ============================================= ./texts/FBIZodiac6/293.txt ======= DATE NAME-‘.,_@U‘_ ENcoDED:a1-xv;-W“ = CASEINHLJMBERJL/-1§|.l.|a a' J ;':.;,;_,2.;» FGFI- 3 '4 6 7" 8. -9- ‘EC PR1‘ ti": —\.l\f FP¢l._|,Lg|_|_|[ H’J§1|¥v}| ! IE f FPGH|';!_|_J ]?_5*lLTLJ#.JJ—flL_T:H:: , TR +*‘.*«‘“~.;=* sax _ Q9" nAcE[:;] AG" LOG L-'3!7‘T[ Hwl ELTW E,_§%E 3!|| FOB CI: 75/ gas go ~ ix" HGT I I ~| ‘J ‘ wt-H :.:—i:: gnwfii. HAIR ' 34”’ Evesflj: U“ _ sun I“ ============================================= ./texts/FBIZodiac6/294.txt ======= ALSA3 - ,. «avail | DATE H N§\M_E-:£1___U_ _ ENCODED:g..sM»T“° CASE '|§3E;j'|§BER:|74r]|! “:3 #2! t-:;;%. .! =9*| ‘ii Fan‘ -1J""':*—2';.3 '4 -5.1.‘. E3__d 7- _ 8 '9' 1C PFIT __f flL€,W_%__ l_-‘__PGL%_ -- mfl1 : I |.i i FPGlfI_i‘_ _| I I1 EC|:|E";"fl‘C_""LJCEI mus-*’"’ SEX 121"} . WQE nncsfi} ADI! LOG EEHII ,__}| I L |L_fi4IFT : H J !I_-|a_;-_ ‘HGT T ~E_'-.'_"‘* ============================================= ./texts/FBIZodiac6/295.txt ======= ALSA3 Wag LH§ DATE 6 NAME rm; % "W ‘. ENCODED;a'fi==W .- CASENLJMBER.-E r o a lEa$z._!s:.;. FER" '4 5___ 7. 3 '9' 19 PRT - _£g-I---5 FR " FPGL LWU F'PcI~I[:Q_£*_I 'WTl{""_|*i|T'Ir“HfJ'3l_9-— SEX nae-a@-' non Lac rcmli I 1| I If E H I! H152. MB C3 AGE H ‘ § HET - war“ ~» -1; ' HAIR F“ EYES sun-r L i ‘*3: “*3, if; ============================================= ./texts/FBIZodiac6/296.txt ======= ALSA3 } H Q0 _ lflg DATE N}iM_E ENCODED:;2-III-'6?” CASE NUMBER.'l,»’J.:' I uLa LI ‘.1i_|.3 I Fan‘ _...3 '4. 6___, 7- __ 8 9 10 that _,m_ I I1.-d___M______ EP¢l._| ~%I | I: II {IVTJLT |='|=-t:I§_I_j_:__%__ I w¢|| I II,.,I H i'1I_'?I I ' _ £.‘5i'*~;,.'? sax @_ "&‘2°¢’tr5” l=lA¢EE% Al}?! I 3 __ Lac ¢M L4 H I I H !LJ H III HwL3L;" PCB :13 AGE |_§._Q.—£}5’ HGT |' __ "— g WGT I _ °_,4-izux HAIR; 3“ 3\?‘V EYES 3:3‘ . ‘Uh 5551‘ HI. ============================================= ./texts/FBIZodiac6/297.txt ======= ALSA 3 0_,H§_q“r’| W 33’? DATE . {L NAME; fl%® ENCODEDML CASE NUMBER:L;4_£ : in n L: #4.! 313 FGH 4 -51.‘ 6___ 7--_ 8% -'9' 1C PET w___jnfl..'- *_ ‘'55 FPGLE -I ! Eé %m§¢-Ii LJ.i_;; :='pcu_%_ l’T7 J1”_i_%LH__é|_I1g|%_,1_'.J|; +:3‘*‘:;<*°‘:’ SEX E} ‘P-<3‘ nnceg} M3-H % Lot: LCJ-Ell I W IE iii _ I! 1.3.14. 1:-on |_m_ AGE IE?-FYI HGT I __j - E I 1-'-‘GT _._w.L_E-E E : I HAIFI % l E~rEsD"“"N 3"’,M.‘~“‘ 51.11‘ EFT”; _ ow“ ============================================= ./texts/FBIZodiac6/298.txt ======= A L S A 3 -. wfl % 6*is’%*0 *$ DATE‘ NAM E ggf E¥~JCODED:;.um;”*‘ _ .1. CASE NUMBER: M]! as? H1-«!,J3 {J FGR .1 '4 .5? 6,“ 7- _ 8 '9' 1C PET ___;____-_m_ __; hfi_ __ 1_=*__1=u':LI I 4% %I D :I_£ }_.LJi _JiDE ML? I=:=t:t_I_+°|_,_\_ml_ _I I 5 D II J |~,_'L...J%_m._.,_f _IL| SE: aA¢E@ Mm ’f:l:l Lac MHELJH E|Cl|L,i%l H ‘N Ln LJL; FOB . AGE %TuE~EF gab} He-at § 1 —L ‘ ,a''* war '* 9 as * HAIR L,J_. Raw’ EYEs”"T‘“ gwfif fi‘ sun’ "‘”T”""l—' my :3-.‘~3u.r’ ============================================= ./texts/FBIZodiac6/299.txt ======= ALSA3 ' DATE NAMEL ENCODED:n»g.w’F“' = CASE NUMBEFi:@]|i alt’ *+£-J-’.;'_3i.s‘ Fan" : 1 ,..3 '4 5i____ 7. _ 8 L9 10 PR1‘ ____H_H_ -_ Ll: FPGLI |.|| I El J___ H II JLW_J_l%2IL|LI\|.g F'pcH_AI_:L.JL ..]T"'"L_J: l:l_l|_I_|I_p;'£_r_l£L_%'_I:l|;".i sax @- RACE@ A-OH Lac Lmi I H l_i MI 3;: non §__ 7; AGE Is-‘ta - _J-t _?-j -3‘-'. HGT 1_1__; WET { j —r i 2 ' , *' HAIR I _J ' “fig: EYE5 -$0 . _ sun F U/ ============================================= ./texts/FBIZodiac6/300.txt ======= A L S A 3 _ qgqwifi DATE NAME ENCODED1 woifi r I .. _. . mu CASE NUMBER:MiU ?4|fl$ LN? FGR” -"1 3 ' 4 .5_'.:'. 6”” Tr’. ;_ 8-% '9'_ 10 PET -_ L _ EPcLfT:N”TTFT“T"”H5“7l% HI iIH| ‘H V #p¢fi%4WH,II!I i I lliili H;wW:r1y:: éak fin HAcE@g A011 :] LOG flflfllliii F: H Ly E1 !%§J%!LlL FOB E1: AaELfig-fiq HGT F7 —' [ we-T __L—-r_LI:; V HAIRI T, % 33 win‘ EYE5___w_|__ '3: U’. _ . SHT ZIIEE ============================================= ./texts/FBIZodiac6/301.txt ======= ALSA3 ,5; DATE ufljgiag N§M~E EMconED:i;I;_Ifl CASE NUMBER3|1‘3.§lo'-I)-:5‘ a... am: Fan‘ '4 6__§ 7. __ 8-- '9' 10 PET _,_W -_ L5 m_._ FPGLI I-if I” L5 II I I I"-"'PI'.:I-I!'__ II “I! I i L_L_|I"_i_LJ__II,I,flL_Ij[:iZ sex IK- RAGEE Ann I I I _ Lac mm I II I; 1 IF“: II“”I‘“‘]I_’ETFi!‘!‘IC”I_“.f FOB T AGE In 5 — qt; HGT I" ~ war I I —§ T"“I‘”‘; ax I-uunl I 3D-9~"“\,r/ ‘EYES :“‘””'“““I_ _ M. 51:1‘ I ============================================= ./texts/FBIZodiac6/302.txt ======= ALSA3 I_73»3”f!’:;::E2J DATE *9 NAME ENCODED2g»I«?'?I"£ = CASE NUMBER:-@I_—n'o'o III ;).-|_! 3-; Fan‘ __._3 4 .51.‘._ B___ 7--__ 8-- '9' 1C PET -E La EPcLLLJI_DLI_E__II,JJIWLJ: Eilll |.L !' I="1=cH_§_TL»J I II I E FI III SE1: 1} nncsgg ABILCSZD me $51! III IL_J II !I II I I I: LIL; Pun [:3-75”’ AGE Eg_r—_§_jp£] |'iG'|'_ |___ -|_,_I_l wet I — -. I! 1-nun EYES I g_ sun‘ ‘I I" ============================================= ./texts/FBIZodiac6/303.txt ======= ALSA3 ~ fififi _ _ DATE N.AME:!w"/V Er~IcoaED:Mw mass NUMBER:fi] :LgJo- ‘t :..—.: =Hr__I Fan‘ .1 "4 5.1: 6_ 7., 3 pnf ' i . . ' La :=_PcL_L,, -I- - ! ' * ' 4!. rpcH£:“?FTW: :_ L. H LJL|ILBu: r r.-.:.'___ -:1 six E} nnceg] M3" Cf_C1 LOG i_t‘;»h!.J4 T |L.,fi If || I If H I! T I! !."*li_M; ‘FOB I A!.'iE L}tj§I_—|'~l"f HGT r —L; - WGT — L L vfiqp ' HAIR L ' 30 M EYES EMT ‘~31. J —....-..._|_«_ ============================================= ./texts/FBIZodiac6/304.txt ======= /éflfifii U_ DATE _ NAME.-_. ‘fl’‘- %_ ENCODEDIP2-:¢-9%’ CASE NUMBER.-IA ah:-lo ~r[__.‘-_:|_ n:::.=:f”1 Fen‘. 4 -56.’ 6..., 9 10 PRT -_ '_._ FPCLI . 1 Luu\.\_\—i]'\- ""I 3 ll I :':fI.~,Ji;a,__§; 1'='PcIfI__H_;a_____i.!f1 1 I? = |L_i 1| |le‘eJrJJLI'j| _II. Sawfl- Jun:-:@ AOH E LOG LL_i;Li_J_Hs[i1 l_jL_ml J”: ! %,__I1 J\_I\— Pan" I AGE I1; HGT |_ ‘NET HAIR E3: EYES 41:. SH‘? Z1" ============================================= ./texts/FBIZodiac6/305.txt ======= ALSA3 % , 537% DATE NAME ENCODED:;:«;u-€s‘I’£= CASE Numseazmwrrrru _.=. . H. ,;.—;_,m‘|q._s_ FER" .'1__3 '4 SW 7. _ 8 9 10 PRT ' -_ L- E_Pcl.__ lfll_J1 ll % -I I il I I it T”"”1iIf71TT].i‘" s=I=¢‘.:I_-I_;[L__| II I 1 !- iL_| “1%_J_._|| “rm;-|aIr i"_Ji _ sE.x- {E} HA-.cE@ _ AMI C13 I-°¢ ILflJI_L_iI E El !| 4 ll ! =;! 1“?! «- PUB ma l£.Li—L;§.2E[ HGT 1- 3 ‘ WET i‘! E ' _ I UQ;-?fi'9‘lq] HA|nL_ “ 3|?” EYE5_ I ._ SHIT C1: ============================================= ./texts/FBIZodiac6/306.txt ======= ALSA3 Q53 jifi DATE NIWE ago”-ULVJ ENCODED:g. 3--W C-ASE lNUMBER:Jj5ZH u'o§a';§'r';{.i_u_+;5«| ' 4.1;;<:,_:??d _p' ."? .:.-:_._;. @ C? 93”‘ DATE mm W fl ENCODEDQ-:%F”’ CASE NUMBER:E¥J a u tI.J—f_!:.? 0 Ftin” -‘I 3 4 .51.‘ 6___, 7- _ PET ; :_-_:=cI.;-1__-% -I-1- I L iIL ILu3]i Iii I H .i i‘ :=po::1;|___ * 'I_JLJ”iJLI Ifll I,L_|L..L3I_'='_'Z _3 9-10 sax mg nAcE@ A0" LOG ncml ! H1 1 I! In 1. :2 :I."7s_* POE‘ AGE 35'-fig HGT E -i Q H. | we-.'r —' i 3 _ U? HAIR M _ 3.0 W "0 EYESE 3 sun-r E ============================================= ./texts/FBIZodiac6/309.txt ======= A L S A 3 I ,_,5o.:§{>¢}j:,«* ;.=*:"5T:::’="“° DATE IQ T U“ NAw:_E;!__'\'»‘” . ENCODED:5\-W;-9:’? CASENUMBER.-E :[o[a »§§.._m, * ' FGIT '4 .51.’ 6____ 7 8 '9' 1C par 49-; F_PGI._| -I-! |l”T"‘EEmCjLTL3f]i J: Ii iii/._i_ :'='pcu¢:;%___ I i IL,_L.JL,,.J I |J§:1|__iLL_|l_I;l sex @. HA.¢_:E@ AOH Ej I-00 117$ |WMI“||:_‘|I_l—7.CT*HWf‘_|!+!_%.—-|L:_' Pun C:J AGE L£_.£J‘ §~H‘‘5'*F “'37 _ __.l_‘;|__J ” HAIR Br“ ~53 EYES 3' U’/h sun j““”[”_ ============================================= ./texts/FBIZodiac6/310.txt ======= ALSA3 _ N2, .K . 1 /c_I,_,1 %_ _ W _ DATE j],§,§ NAME EMcoDED:g-Wan - CASE lNUMBER:L¢§ : uia 1: .L:',L5 3} |=c.-.3" .'1""'-'-2'._.3 ‘4 SW 7- _ 8 '9' 1G par _ P __ If-‘_PcI, Ll -HI i E n__ aaagzs 5*: a ; I=I‘-I-:c:I__l¢__L_u_____I:lL_]_Wfi_~E ll |LaJ_0_lE I i_f_| E F N7. 32:: LE]- ant.-.E|E] AGII I LacE::.6.§|II I .I%llii£1I§.lZ PfiB I AGE ll! 5 —|tr§r..: HGT. _'_g__ . ‘HGT — 1 _;’ _ Uwfifl Hmnl _ 3“3~,.=,-U/ EYESCE . a 51'-‘IT C1 ============================================= ./texts/FBIZodiac6/311.txt ======= ALSA3 Ea DATE Ni$.M_E ENCODED CASE NUMBER:E"| I 0 0 :1“'«~=~2- '4 5': 7-, 8- 9 1C FER" PET _ "44J§FW EPcLli H J :WH F- "WI" FFGfiimm_L sax E1 '1'-IAGEQ! Ann ZFhT_ :1 Hj§WV LOG IL?-_H FOB L_ AGE Er HGT WET HAlR| E EYES EMT I I l I 1 HI ============================================= ./texts/FBIZodiac6/312.txt ======= ALSA3 A fig DATE NAM_E:_.__;*qU’ _% _._ ENCODED:g.W14*g . CASE NUM-BER:{,gMj§: ‘M. L. .,-L3,,r.: r :=aa"."1 '4 6"” T 8 '9 10 P17-{T _£ ' FF|3LL_._1.J§ El |_i_i| J Hjma l_='P¢_!_-I_£:i ll 1 H 1 Li H E ILamIf ? I SEX: GE RAGEE Ami I-13¢ EWVE il IL [EH I 1LJ,_‘|u;%-_|.__!i_;_ FOB E3 75/ AGE EE-E HGT Cl_j-I I WGT _%_-f i_:_' J HAlR| I E‘fE5 __|_; ' ' , __ sun" :1 ============================================= ./texts/FBIZodiac6/313.txt ======= DATE ,-4;. NAME;!ifi' } ENCODEDJHW‘ CASE NUMBEFl:§;4H: U .4 sen '4 e__ 3 -9 1t: - 7_ PR1‘ 373 3,1: I 1: I'll FPGLC!_§§ 3 I $2.1‘!- :'='PcI_4_*L;:L._iL.J.mj!_.._,f..L.4=I %LasI sax fil- nncsugg ADI! Lac WW: |”II H H !I!%|%‘I!.r1!J-i- | __._ FOB |___C AGE ll+To - HGT | I z W37 1-CE! 9-D P11 HAIR ‘ - ‘W’ EYES - EV’ . sun 3”" at Ifiwl ============================================= ./texts/FBIZodiac6/314.txt ======= 3i§:,:g,E§ a DATE ' 49- 4&5’ NAME __ EMcoDED:M1-in CASE NUMBER:L£,j§ I ¢.m~§,,z}.ss :4 '% I ran" '4 6__w 7 _ 3 9- 1:: PET -__ _ - j,L_ FF¢l.{.1__1 -H jl EJ il II i I 4: IP13}! :'=:=-:::::_n__1_,_r_%:_ H J H I 1 1 JL_L._JL_L_.iI_QE:rZIE_: sex RAGE|E Ann T”. J _ LOG EECECDELJ l_%I f”1|1 i|_F§i_;:__ :=-on L__ AGE L‘+o_-~H-+ HGT — ; war 4 —- 1; _ ' HAIR :‘i__% _ 30% EYE5[::[:_ 3‘ U,/,_ SHIT II: ============================================= ./texts/FBIZodiac6/315.txt ======= €335’ Jlgqfiy _ 4“ DATE A? r~u-xME:,.g_ ENCODED:a']B1'3J CASE NUMBER:W ,5. |.»,|«..: :1-,a_!.s;'| Fan‘ .1 4 6,__ T-__ 8 9 ‘IC PET __::_,,_M -_ _ ~'3'_ FPGLI -Ii I IJJIME :|_ II E II I !i I I-P1:r.|%! u_=':=cI-|_$I'_%_! ll 1! 3LJ__J|_LJ|_I_||_l_I|_,,l_JiE£|E§ sax LE- HAGEE AMI E1 LOG rT3..?l‘I£ II“-‘!— [7 !I IV”! ILJ! I. .*i_,,;_ POB AGE |‘+ S" — '«-s ‘f HGT i~ I wtrr TT—§ % _ FLAIR 4 3,0 },Ul£‘l91.1 Eves; ' _ — ~ sun-r | L”)! ============================================= ./texts/FBIZodiac6/316.txt ======= ALSA3 fl:,;;;» ,‘=«‘;f__0{,/>,_rl;,-=.:':r DATE NAME Emconzngfl ;]fjJ--£3’?/fié CASE NUMBER:_L,P._l to a ‘4f.=1.§_!:L-9 .=an*.1---~~=—2;_3 I4 .5-: eé__ 7, 8 9 1: PET M...;__jjfi_.__... FPGLII-E I I I IH II I H I{= Hfélii i=‘:=»c|-'n__'I:_’T”II I. II I III LJLI I|_wLM|E'fi: sax EI- nnceg} A0" Lac $F£L__I..II I L "II III #1 I! _=_;. nos :5: .35/’“ S AGE |_ig_‘[.£:-I HGT 1- —F I I I W‘-31' W —'Lw._I_.._§ ' HAIR ,L.m ap 1 i EYES 3-HT" ============================================= ./texts/FBIZodiac6/317.txt ======= CASE NUMBER:Kf! ; Jo Fan‘ - 1 PET _@. ALSA3 DATE NfiM_EL ENCODED EF¢LLQf :=-=~=-am sax @- nAcE@ Ami :5l‘} fi ‘fix Loo E4 FOB |:|: AGE HGT I Pi I l!_g: wen" __ HAIR I EYES SHIT SW1; 39:5 fl\9._"R ============================================= ./texts/FBIZodiac6/318.txt ======= N!5uM_E:_. Li“-""'L’fl__L ENCOEJED:' -IBM = CASE NUMBEFl:Lii I .9; Q fig:-1; « FER .%1_._.3 '4 5.17.6. 7», 8-- '9 10 PET fl ; firppffiin % V”i H“ FPcfl££&W %L-il :3 sex fig nncagg A0" EIj:I1 1? {I !% H'gM 3 1| Jil Hf}|lf7Li“ LucifET Hi I til :7 H. F;1£Z was g’ AGE Ej- _!! HGT ”"”—FT—V? _ b&? aw ‘HGT HAIR EYE5 3n.‘."'fl'U,)/ III. SET 1 ”_1_W| ============================================= ./texts/FBIZodiac6/319.txt ======= %ALsA3 u ‘fig CASE NUMBEFi:lAi no um?::I.EQ7’-I Fan"-'1""'."””3' '4 6.” 7L _ 3 '9 10 EP+|:l._.1"i§3-I3 %- % I 2 J1’? 1% ._J. |L._I"] .I.1 _4 ! J ITWI“ I |Lh.J.._JI_t_|ET__l|:i_ ============================================= ./texts/FBIZodiac6/320.txt ======= ALSA3 Mg *"7J3¢:I»‘?}g/ DATE , L/_ C NAME-L % EMcoDEn:§-gag?" CASE NUMBEREL45 : 0 a ti 3. _[_$|'f§ Fan‘ :1 _..3 "4 .5? 6.“, 7. _ 3 9 1c PET #1. L- EP¢L|;3¢ E I I {I 1 llillé _ Ii :_I;““":‘ FF¢fl£$i_ 5 i i }IaIIi_H_LJL£jL;i sax Q; nncagj M3“ Qm:i:l LDC gag E H € II I! I! H .|;L;;_ pen LEM AGE IE§,- -M HGT i i— ~ fig war E H % 2 "‘ an ,%.;;:x HAIRE ; 1 5‘ mg? ============================================= ./texts/FBIZodiac6/321.txt ======= ALSA3 % 53¢ é{f5»99‘5 _ , an DATE _ NAME _ .. ENCODED:£9wg‘*‘=«‘?1£""”? L CA-SE NUMBEFl:{A_i .« C: 0 L; ;.,Lw§-£7 Fan‘ 4 6.” 7- ,_ 8 '9' 1C PR1’ _£. - MW___ :_=%|=II.'~.Ii._L1_'fl3_‘_L%&.Ei.M ML 21 I1: LJ .i_!' 1=I=I:'.I_-I_kEL___A,_L_‘f%|3 :J.J'___Jf“1iII SE: LE} I-ac I HI III! r J! m:_:; ============================================= ./texts/FBIZodiac6/322.txt ======= ALSA3 J . ,2;/5’L’*"” . U DATE _a’=33":§E,, NAME 1 ENCODED:§jS~3] CASEINUMBER:WflLuo@ u;_,No FGH PHT ’4 6____ 7% % 3 9- 10 FPGLEE _Tw I JPPW Frau sax mg use mfl"‘I"“:I lL_J_1 1 m I I|""T."”1e 4L ============================================= ./texts/FBIZodiac6/323.txt ======= ALSA3 wfikfi 0' ¢.;? DATE *5 - u NAME EMcoDED:;.I%afiW CASE NUMBER.-WI Ilblfl I-II-5~.D',r “' I-an" 4 .51‘ 6..., 7 . 8 9 10 par 2 FPcLIH- FPcHg§ Ir» II II___ I II’ IEIII II I_' II_ II LJI I II I I*L_.|*"T'JI:i;- II II E. E SEX BE nAc_E@ AG!-I I I LOG ILMIIIII IIV‘ I I TT‘T” I IILJ H V Pan :3 AG£‘Ffi~fijj ‘ HGT LJmLJ- I ' war '7 E—I I 3 Vjifi‘ HAIR E3: % 3% up’ EYES _ .. sun" I I ‘Ia’ ============================================= ./texts/FBIZodiac6/324.txt ======= . DATE NAMVE;!_"°.;_ ENCODED:&fi9nEir7§- CASE NUMBEFi:|_l‘3i I 0 o '*3.''.‘1.!,§ }' 9:, FEB" 5__3 '4 .5_'._' ‘.3’. _ 8 '9' 1G PR1‘ L . _ . FPO]. LL3.i I ET”‘”$F‘“ 11- ! F . I'="!=*¢.':I-Iii‘-H’-1-J ! I E: F E II E IE I SEX [EL nncagg AOH 3' : | Lac I_c:QJLuL_LJL I 1: L__:|% ||.'Ii 1“7'LM; Para :3 ¢»:.,/ AGE ?S'0t—1§;rr HGT [__ #— ~ ‘HGT Q __J—' I 1-mm C11 ' ‘M Evzsfefl 5) SHIT ! | ============================================= ./texts/FBIZodiac6/325.txt ======= ALSA3 NERME‘ % “flu EN 23<1*9f/G- _ coDED,‘Ll_ CASE NUMBER:fl p .3 L: _.r—7——.r '_f- ' I‘-‘GE . 1 ._ . 3. 4 6__, 'i’- __ 8 ' PR1‘ I51 -_ I_-'fPr.=I._ [$5 |_|_p%'_tEJ..jL,?,Jw.Jl_ 7. I='I=rt:I-_I__r____Lf_._‘fl!_l_I'_»_ii_ 1|’ ll F7 sax RAGEQ M3" ii LOG $01’-.‘.J% II |\_ H 11LJLJ_1L_|__JLW[_|i_;_ Pas 75/ AGE tin:-%—:9z:€' I-IE1‘ q H J" 1.-n:1'i —j-__! ~ :4 LR" "J"°£ Hfllfl 3.0 EYES 3,\ U), SHIT ELW ============================================= ./texts/FBIZodiac6/326.txt ======= ‘I-'-‘RT _ mm M 5. -_ FF‘-T_L.E L_._w3L£L1:.LLfl_i,I : H 3 ‘LA .: fl L513 3 ».W" "DATE ,¢ N'AME.: V“-“_ ENCODED:3'?['i'”*W - 'l'\lE.'J'l§1E5.r:*R:L"g:_|§'1'E:-'|'.::§a.,:§;.2 _ 7 Q_ FGR- 2.... 3' 4 --5' '6- 7. '8 9 1 _...;...,__._ I '5 J i!PGL3-bL_}|||||l|__,i_££E FP°.!:I;...E I? .'__\_ "st-:x Q3 1: A ca fig _ hi DN:__4:-u-_.-L:\ 3, _. ,. E l . __ Lac {Mi I E : I l 3% L_ii -_a n._ T ‘I Fun [I 753/" A_c:E__..F£‘Ff2”i M: .. _ _ . HG-T.."E ~ 1 ' ' ~ ' wcrr [ — 1 ; § " ‘ mun EEK I 393$?‘ EvEs[:_ 1" sun‘ CIT, ============================================= ./texts/FBIZodiac6/327.txt ======= ‘PET _FFGL% flflJSii3 ' . WU my NAME; ENCODEDA-M? J?9“3@ DATE & *9“ .5mé»:_i:%:»| cé;'éE" NéJm'éEn}[|';aL:L FGH- T *2m 3' _E 4.m5 TJI IF: LIZLJ HIWH gm |Hfi|H '&, T_'8 9 1 II M I]? Ii; h T77 Frfiflwh. ITLfiaH "sex fig nncegg ADH =.'-'2'<>~.é.-. -' »:-*~»"--..".-'-'. .- . . - -:~'3 -: -- ' - - -.~.-:~»:-_’-"'.-~_'-'«' . . LDC fifiT!3IJ 7| i!l U FOB AGE 4 Her’ war 5 - HAIHE I EYEs[gI SHT [7—TT rj} fi1= ============================================= ./texts/FBIZodiac6/328.txt ======= mCASE'''N'U'M_E§EF;.:'731 : .«.»m,1ggr flLSfl3 £735? _ U DATE NAME; ,_._,~._ Ewcoo-an; -ma ma» 3' 4 ---5 6... 7L 8 '9 1 "PET _ __}~1 _ FPcyE- IP13 FPt:!;I_g__‘_ I % Piai '"”":J—| sax fig aacegfi fi0N“EE::I3 we ma F" I: _JF_:%“.7|.l. an 4: ‘L Pun £1: 7§“’ aefi Eli‘ E’-5”’ .. HGT E '—r we-r E1333 - HAIR: I I an Y'p\°'~“ I-=YEs£‘*:“ °’ W” — 5H7 CIj:I ============================================= ./texts/FBIZodiac6/329.txt ======= ALsA3’% §E3, r~aAME%:_ ENCODED:§-IW”;[' L CASE IL\J'LII"\r1.'.BE'iL.=i'.-Isl. |.? 4 5%; ..2'_..._|_g@. '" ' :=an- 2,-. 3' 4 6.. 7. -8 9 1 "PET H ‘_ _.F'PC.|.._'1:_l"_|% 3 3 ELK? l ELM] lir } 5 I=I=*t-f|'L£:J__=!E 1 ! JPUILJ If i "SEX @ E: I1‘ 3-! |—|Fm_“? I T [:l_ ============================================= ./texts/FBIZodiac6/330.txt ======= 5 , _ ,0 DATE m_,flC_,,% NAME-=+¢‘3’_‘._ EMCODED-,;w*rr % czgss N'u'M'BER.¥Lg; : :2 m4. ,2. _rEm7 _ FGI-'1' 2--= 3 4 '6‘. T. '8 9 '1 "PET _ rd ' FPO-.l._L:|~J E giénl 1 £1 Hi 1: _ii L47 .-=;:»c._u:fl§_]__fi__H,J I 3iiLI"fiI 1: ]_WL iCi_Jl: "sax ma nncefi -~.--3-.; :.-» -. ....--~». .- it Lac Etfltl %| TF1: 1 1 Pan Ej- AQE _EE 5. -*I'+‘i HGT I: — ' ' I‘ we-.'rL — = 2 _ - wfifiyax HAIR C::I:I EYEBI: _ - sl-IT Ki} ============================================= ./texts/FBIZodiac6/331.txt ======= 4 "P31 N fllfiflfi % {fig T L, I NAME; ENconEn:w«wJ”= GQKSIE NLUMLBERMJ woe} 'L+;gL..J..F!F7fl. % was 2 3i L-~57 6-. ?% L3 '9 1 _I=PcL_Ej-_Ii H% Epzu J EWE; .| -I‘ I FPGl_'!;__E_3:__:J 'L_1_§ C1: CE L_I3 ICE CC! 51:] |: ‘sex 13] nAcE@ L¢c EJUIIIJ Lj_ 3-H. H1 HI-H; FOB C Eh?-'.E E0 _‘L§{&_l I-I?a'r-' E; ~I r I "WET E? f — : _% % HAIR E-__§ ' 3'3 at EYE5|:__|__ I ’-"\3’Qr,./ - smr EI___% ============================================= ./texts/FBIZodiac6/332.txt ======= fifl.3J§3 ” KQ 63%;? I I WU DATE 935 {I NAME-919% I _ EMC0DED:Cg'»l3-fir I cI.sI: l'\.1..LJ'l".fl'l§ER...~'.E’I'.J..~'é;!..'!_.I.!'f.."LJ :=cai=:- 3 4 6-. 7. '8 '9 1 ‘PET __?__,__!l_ ' 1! .FP¢I-_E I I II !_P%,1_L_LJ_.J_LJ| MI: I II““."”“I:‘° rpGi.,Q_ I I i I ma L_J I i 2| lJ_.J_||_I__|!:: sax gm nAcE{@ I-ac {M F“ ILJ if‘?! IL: .1’ II %. IL_II pan [: fififi Eifwy HGT E —I I I we? E — I: ::;*;E# I __LJ UV'“ 5*" E:J:[ ============================================= ./texts/FBIZodiac6/333.txt ======= ‘Pl’-IT __ D__ mg; -_ fii.Sfl3 ' ' «*2 ' q €92 DATE ’ , D _ NAME.;’__ ""q ENCODEDz§i']’T~[?I/F? ' 'c':A's"EL ?~.!L'JM'BflE'R::E:ff';."J.a' X: "V " :=c.:'a- 3' 4 ---5.‘ 'B.- 7. 8 9 1- FPO.L_EEE'fi*“~'fl| I LPILI! igi ,_]é i I _ |L..._,,. 1=I=<':_I_-1__c§@[1H=-]L..]_ Lfimtfifl I‘ HT": J‘: .““”T‘”1 F“ 2I“1\..: '55:: E13 "J7 nncegj nan LE3: . .. - . . .- LOGEVEHIQH E“ %Fi—]FJ|_J!i.L_; F03 C:j 75' AGE E+_nE—m=;=hr HGT E_] — - WET CL__—a 1 ? L % ¢,v{=5‘_fi,£_ HAIR C__L_ % 3° .47" EYESCTW _ EV“! sm Elli’ ~ ============================================= ./texts/FBIZodiac6/334.txt ======= 31.353 ‘ = W313 DATE “um; N-AME_: w‘s"”’ L ENCODED "G.*'1\'S'E'i*'~i'l.i|*111'E!EF:":,L$E'J|‘.§1.'.c: a1» 1; .1=::~ +1 Fan. 3' 4 ...5.: 15 7 -8 '9 1' "PET - T __FP¢L E1211 1 11 ‘SEX E !_1"““1 1'9:-L11 1 111__ 1 11...JLOI3iI,L_|L_.JjL_' I=I=-t‘.‘g'!gg_‘_$1:___,~ 1 1% J '11" nAc:E@ J -a_-.. -_M_-._ ,_.--_-. . H1 1?.-l‘1__" LOG 112,111 11 LJLIII 1111.111 “*3 F 75”’ 1 I HGT 1 2 1' ~ 1 " W131‘; 1 1 -1 1”’ mun 1 EYESEW: star 1 1 . . | ============================================= ./texts/FBIZodiac6/335.txt ======= ALSA3 DATE NAME; _ ENOODED. ~ CASéP“flMBERHflfr0fi’”9a:%fl ‘E. T32‘; ._<‘h“ Fan" .1 '4 3 '9 F H 1' __ ' . j:;:.;;... . F P c I. l,__.% E E _ F P t: 11 72:» sex E. %-$Qu‘3".§:.*="‘“ nAcE@ _ AG" |.oc|”Z1{Ié?'””:L_J LII !iE1!I! ‘,m ww- C3 1 .1; ME¥¥ ELJ‘ H E; E HE HE! -~ {T I:-as E3 AGE L>:u%—|:-+ HGT — _; w::.'r j__— -3 ! HAIR "” EY’E.'..-'11:: SHT E ============================================= ./texts/FBIZodiac6/336.txt ======= -I _ _. . _' P In CASE NUMBER:I,_4 frhfal ~r 2..I-an _ 6 PET _m ; « _l’~h_ FFGL %_ - ' FP¢H ' LOG I5-izflfl | i! 1 || ! Jmll || ? pun Lb AGE[E5-7! HGT I — WGT '" ~ ! L_.£ HA1H.EZ EYES | smf ============================================= ./texts/FBIZodiac6/337.txt ======= |~.:AME~;;_.l0' __ ENCODED: CASE Numsen.-_m1 ; 3;; é;5__r7~1a.9L£_fi,£=;2#;? FGFI" _1 '4 6‘ T. 8 -9- ‘ID PRT ____¢{ J‘~’.-_” " _ FPCLL:l.w—.3'HL:l'§1 l—'§9-3! iiml I #pcn_WjzT ILLJLi;]|_?'.i 1 ‘I sax §°,§v*G;5’° nnc-.E@ AGH i E l LOG EM llii ll [I | it 1 !§__|;l-___'5;‘_'v Pun AGE ls: EFF"-I11” HGT L i WET"? 3 ‘I I I HAIfl|— E EYEs§j:' snrrfll ============================================= ./texts/FBIZodiac6/338.txt ======= DATE _ - C5’ :~IAIx»IE;,.\“"_,ufi__ EMc:oDED;m_- CASE NuMBEI=2.-DUI !.D.|5|‘%|#.!_r?|1§ 1=c.n- '4 6” 7. _% 8 '9 15 PRT __~ I _L__.___:_I__ Fl‘-'Gl.T_ II I Imf!I _iI I J|___#.i 1'='pc|%-[gm CE _I .}C_i _D 3 3‘ 55:: $1 ‘~‘I'{«"?.;Jb nnclsgg A0" Lac IT»Uf1f| I I?“ CTm!i_m! [N "I! E. El. IL; FOB I AGE i_g5"’I_5§( HGT I §__ “‘1- - ‘HGT I I ' J HAIR EYES _' i sin I I ============================================= ./texts/FBIZodiac6/339.txt ======= ALSA3 DATE NAME;!L ENCODED: E ~ CASE NUMBER:”|,,Ai , ale: u.;,_ 3.:¢:.I,5.,E€;L§r"-' sen V4 6____ 7. _ 3 9 10 PET - EQ Ercu LI §L_l_-%”T‘L_.. i% “H _f""T“"|1 .-L01-I 1:1:-c::_aL___:$__ H :: ;;MJM,1r n"“"fl f_"|_‘Jf—W_L VT] rr SEX um I RAGEEE AON E? ; LOG L:-EFL? W1 L_| II !|l1T”JJ!|l*FjE;§ FOB M AGE $75’ -175:’ HGT [ J- i we? H; +1 7”: HAIR J '_H_J EYES ;J fl SHT I ============================================= ./texts/FBIZodiac6/340.txt ======= ALSA3 DATE . flu NAME ENcoDED% GAS-E. NUMBEF::1a,ArL.ya Q! §;:L1.! we ‘3©“‘*”‘°’:¢"é-fig amt’ 3? F133" .'1""'-«a-2--___3 '4 .53..‘ 65“ 7.-__ 8 '9' 15 PR1‘ L- g.¢_M _ :==:=c:.1::] lfiil ||1||||iH| |.% |%fl _ #pcHEJ I 1 1:__J:LJL¢JE4#M4EflLLJE: -. _ sex I Iu.¢EE mu '1 Let: Em FOB AGE I5“:-'-' - arr HGT LJ 5- I W61‘ 1 - ; HAIR EYESL__ i _ .- sun‘ \:|—|—j ggnwza L IE;|E!% HLJ%'-L; ============================================= ./texts/FBIZodiac6/341.txt ======= ALSA3 ~ DATE NAME-:,; E:~:coDED%._. __ _ F EL .. CASE NUMBER:|,a,f|r!'c;’|c:- H‘ ..L§',fq-c;- We/Z_,_#,3 FGH -1 _...3 -4 6___r 7 _ 8 9' ‘EC PET . L EP¢LL#LJ£_Jl lil 'I_ “H zrbl J}: FFCH_l;/h_5fi:v]_L__ I! 1 H Ii J_,|L_I:L| awn: i“jF“='f sax @- nAcE@ AMI CZZZ . LocI1eg._{IaI |;:L_[;:|~.._|;g_"_g POE I AGE 5' 5‘ —| :e' 5’? H51‘ if“ t— % : WET C111-EI:C3 I-IAIH r‘“““"“ EYE-SF“ , . , .. SHTEI ============================================= ./texts/FBIZodiac6/342.txt ======= DATE - .0 NAME;_1_“q _L Wconan: ; CASE NUMBER.-W. mic ~+-W Li L Mg; FER’ *4 .55: B___ 7. 3 '9 1G PFIT - - ‘L H__ :f_I=-cu 1.I.I.‘I L E... tF“T_II Jrll I Ii:-LIL; E 2%! :=pc:r_I%h,;_.%% II r: 1___.,E|'_._l%_I_”t|_l_iL.£L‘lZ1L_a'_|L?,'; sex E. nAcE@ Ami '_'jjj '-0‘: my 5l‘"““]l: I 11.1! FOB AGE ~+='s'—~rE‘i HGT l—s“'—g—r'"fiJ wet 2 [ —f -_: HAIfl[:§: sun‘ §1";_! ============================================= ./texts/FBIZodiac6/343.txt ======= ALSA3 NAMELQ _ ENCODED: ~ CASE NUMBER:f_m§: a o ; 1r .Lf_% L: ? m‘:.£-;=§—‘- - Fan ,_._3 '4 6%” 7*’. _ 8 '9‘ 10 par . L. 1=|=-cl. I431? mil i| I Ii flak .i I'='PcI-'I_ |"_f| I H %i_i_.JF""T_lW_|iTf|—E"§1l_T'_||—'?': 1~—.~.w.'_,', H SEX @- nAcE@ AGH 3 Loc i|T—V_EET7 .~j|§|I| i|§:L__;_ 1:05 |___ AGE Esta —L; '4- HGT L 1- 7 we‘: ; :*"”""—-,”% HAIR 1 EYESEZU , _ SHIT ============================================= ./texts/FBIZodiac6/344.txt ======= ALSA3 _ DATE NAME ENCODED: - CASE NU.MBEFi:L5J|_; a o «-1 av .: L: .9 1m¢;,%,;§«~- FGIT .1 ,...3 4 .51‘ B___ 7- _ 8 ' 9' ‘H3 PET _ - L- FPGL L13’-L_.II : il ': IL flaaarl .11 iL 1'="'pcH£T_J I I! I i Hf‘ H I__Jl_| iL=2~LflLI'_lE r‘. . ..,_ SEX [EI- .RA¢E@ AGH I LOG |C.i P1 pan AGE HGT wen" i HAIR J EYES-ljI' . - SHIT 11:]: H F. §§ " W5’? -2 a L 1 %! [mT7!|!iJl||i?l|!i|@;; ============================================= ./texts/FBIZodiac6/345.txt ======= ALSA3 DATE , .A.I‘.J_ NAME L_ EMCODED: L ' CASE NUMBER:|_7J”.i I'§c'.!iaJ ~:.r.J.!s' >.z"“'“""’ - 3 J- .~ 2.»-"3<«-'“~_;‘-,1-" 2- * sen .~1 '4 6” 7 _8 9 1:: PET FF-‘»:L| I‘-II LJL 'aT“”:l‘ 1H£1I!aIT1 .i !' |=I=It':I_-'I_A|___%_l:] ': I! H 3? Jl‘J'?QF“”T|:|_|F|"”JI“’i‘.’ STE}: - nAcE@ MM! 53:} Loc JT-"EA Ill 1 EC”: I !| PDB AGE I5’ 5‘ -| ‘E35’ HGT {"7 = |— L| W57 _._,__1__‘f.__i:j HAIR J EVEs[::2: . .. SIHIT ============================================= ./texts/FBIZodiac6/346.txt ======= CASE NUMBER:LA1ii:%o!a ~'iJ»|.!:-' c— :=an'" ‘.4 6___ 7- _ 8 L9“ 10 PR1‘ E- lf_FGI._.'l - -Ii? NC El_ %EZ:L'i §_.J% ii LJ.i FPcH‘_+%_§_LJW_!';iE__lLE3LamLu|aLJLJj;_ sax gil- ancefig Mill CCCII |.ocIT..m.%“1"“:|;'I’1I!L_J1I;:LJJ:I.;:i P63 {::| AGE Li!-' HGT I wear F" HAIR.‘ E"l'E5|_ surr |‘_ —‘?S" FFMW ============================================= ./texts/FBIZodiac6/347.txt ======= DATE NAME;1_fl.__ EMCODEDI . " I. ' - - —. .. CASE NUMBER:DFII:L9J-5 H 2.1.!-iflr’ M~.L,mz,,é¢' Fan‘ :1 ....3 '4 6___, 7L . 8 '9' 10 r-111' -_ E? :5PcI._I””:'JTT7I L_|I EIPILI.-I i" FP{»3|jI‘_fl[h___:v_“.JLv_.J.._|'I_._.d. 5;‘ sex [ELI RAGEJE Ami I ll IL I |J_J |I’t°I§l|\'é'_: LOG Ieilfljl I II I ELM ll 2 Ia I I II I ;:__-:=__;_ FOB AGE |5'.s*—_:{_:_.'_ HGT J - | ‘NET f — I ;’ HAIR fljj EYES Q‘; . - SHIT I I ============================================= ./texts/FBIZodiac6/348.txt ======= DATE NAME ENcoDED:,j CASE NUMBER.-mE_. Fan‘ '4 .5? am 7 __ 3 9 _1r: PRT I5’. ,.,_,_..I;,_ FPc'LIrs-3-IIIII" §|IE%III|%I<:‘|I l_='Pi.':I_r'I_hI1_v__£:FI?_7;1l I III I I: II I'“7§_ML._;\_|_§U:l|.:i.: $Ex @- nncag ADH I I I :3 L00 It-IxI_II I II‘“I I L_ILJ II I II I II I_ as I:_;_ run I’ AGE .l‘rS ‘WE? HGT La E *I I WE-'_|' I -I I- HAIRL EYES - — SHIT ' ============================================= ./texts/FBIZodiac6/349.txt ======= CASE NUME!ER:LAHr o 42_i_:+%.z.A.H8:1W-;,g»_,,,;~.é.g;';é Fan" .1 ._..3 44 -5''..' ES___ 7- . 3 '9’ 10 PR1‘ __£_ '- _ __ ,_ FPGL L915 1 l L_.L_J|_. ii i 5' ‘~15 ' ,_"'* ' ' I %| I | J | sax @ -nAcE@ A0!-I Lot: 1 i II II !L._J lL,~,!._,__l|_l_%Q._lL,.;,, PDB AGE {TS -l_'1S§ HGT LAW - 1" I WGT i_3__l- 3 .J_' J HAIR 1 :—:*rEs:\:.:£ * ‘ sun jj ============================================= ./texts/FBIZodiac6/350.txt ======= "PET _£ ALSK3 DATE ' FL’ NAME: -___1“”'_.L _ ENCODED: ‘ CASE NUMBER:_[FT"I : 0 alteia. 31%? ‘':{::g::;{ raw 2..-. 3' 4 ‘£1. 7. --8 L9 1 I=PcI.:flB“37|}”l—1_|”§[7'“i_.F”T7 ILJ ii lm] F-qP'c.fi_;.,.;EL_filJ Ll_% L..,L._JL1,,.,J _]_l I44 um.‘ I:I:Z1 EA 1.: E "521: E; RAGEEE LOG .§]':b°$E N 3. EL !1 Li JL4. |L- FOB K: 15, ‘E F . HGT E; -— §_ V-‘GT §:E‘Cl:LT'.; HAIR E ‘EVEN-_:E:[ . “ SHIT [‘l’|" ============================================= ./texts/FBIZodiac6/351.txt ======= ALSA3 _ 49 DATE NAME;%“_£.%_ Emconeogj CASE NUMBEFi:[n:’L; 0 .4 q ;.,L3r31¢;¢,gE);m FGR '4 s_%_, 7 _ 3 9 1c PR1‘ 2. - - EP¢LEJ:@£’”LJ 9: il__ I 2 ' FPI':Ifl_a°l:%f_§.-‘%~_|| LM! 1 H: ‘Ni II: LNéJ*l_|E"'__lC' sax @- BAGEE! ADH |_:_ {] Loc[__£'-_L1I%iF“II’I> ; Iii||!!__EL_;f FOB |:f: AGE [EE$i~ HGT | ; _j—| V“-“"' V7”-E mun CC3 ETESCK . _ . SHIT Ci ============================================= ./texts/FBIZodiac6/352.txt ======= ALSA3 DATE NAME; E1-1c:o:3ED;_.____. CASE NUMBEFi=LsI:I.« rm ,»u.u..r7 57.:;§::¥7s/ :=::=.n% .1*-~2-.,..3 L4 .5; .6__v 7. _L 3 9 1:: PET __&__._H_m -_ I_=_|=-cl. La_L‘s_-- il EH _ _;'l”_J”7| 1% I: I Ti I FPcIfl%|_'TJ:_a7___J 1!] : L ;“1I“‘fl r“T“H’I‘I_ '- ---m. |_ SEX @- RAGEE AMI - I-oc EM L....,H ! H II _.JTJ I L JT‘|;—..F'7Ef POE \____ AGE E3:-WT Hm" I ? —r 7 Wm‘ r —| 7”‘ HAIRL EYES sun-r “___|_; ============================================= ./texts/FBIZodiac6/353.txt ======= ALSA3 . . W DATE NAME-‘L ENCODED: L CASE NuMBER:Efi.Ew;;¢V,E?,- ran‘ .1 '4 -5*.‘ SW 7- _ 8 9' 10 Im P81‘ 2. ._ l_=_P¢I_-E-‘ZWJ il ijl % :I_i I! 3: :5, FP°7€'.;5L_%.;%_JU_J';4 pi LHLZJV: ta :‘|_| II :3" sax - HACEE} M3“ I-01'-'= |"—i«"-ll $1! I lF_| Ii ill I 2: JJ§—Tj?' 1:-as J_ AGE l?|?-"ff? “GT ‘ ‘L I I wt-.1 ! n; 1:: HAIR EYES“'_g_:_' SHT “ ============================================= ./texts/FBIZodiac6/354.txt ======= N£ME: CASE NUMBER.-ML, 9 a|~};§.J.!”fw:1J wflwgg ran .1'“~2“;.3 ‘4- .5? 6%, 7-_ 8 '9' 1C par {-1 ~_ ll 1 I E$_ji l_=PI'..'-I._ {"1 - Fpcflfi ‘*3.-1-.'-.... Sax fig n.AcE@ AOH IE : EL _ ' a«3’_||7L_Li V|,lL;_I|Ti|_| |iL:|% LOG@':fi{|||iH%[%i| I! IIWEL-i7_T FOB AGE|§5'flT§i HGT I “E %- i % WGTEJ — 1"? HAIR~wL_ EvEs:j:Ij . -- SHT II ============================================= ./texts/FBIZodiac6/355.txt ======= ALSA3 DATE NfiME ENcoDED:j= CASE NUMBER:[/Iiwio ama...!:»-3; HEW}? Fan‘ :1_...3 '4 -5:.‘ 6_._, T .. 8- 9 10 PR1‘ m Ii -_ I_=_Pt:I._. ~-- IPLI 13iF__ i I‘: _JI1i..L LA: FPC.":Ij|___:h____s_ "I I I! Flo !aLo[T H ; |:_ML_é%__|_.|E"fll:§I SEX RACEE AMI Lac c»mI . !| I H |l,__Jl I 1% 11.121»-L; F-aB':] Ac-E fl-EB HGT I Q — Z WGT —*%[- ;: HAIR . f__ EYES . L EH1‘ ============================================= ./texts/FBIZodiac6/356.txt ======= "PET _ M S» fli..$fi3 DATE ' -L» NAME ._ ENCODED: GASEHNIUIM-BER:'{I-1j%.;[ Eb" l.éa".”:.i ;~m;:g:jjE;7 :=¢.I'=:- 3 4 ---5' '6” T. 8 9 1 13:; {Mi H'%HiJs: j_‘~_£:J%_§_ I :I_%_|i_|_||:. _I'-'PcI._ L_%- E H’ 5.1% Fl‘-‘cl-y|_:_dE__@ |_|_|L€J§,}E sax gm nncsfig LocDQ7fiI"IJlLI !Wj|%.I!+!J.|:_- PDB [“‘“ AGE [To -5 at HGT E — W‘-'57 C - J 1 HAIR C233 EvE5[T—nj _ H surr [WT - ============================================= ./texts/FBIZodiac6/357.txt ======= ALSA3 _ _ v U DATE NAME-:,__l"5"-% ENCODED_.‘___..< cAséfmfimBERnnH;m§$~hL,2;1§fifi§#' Fan‘ 51 4 6._ 7- __ 8 9' 1C PET 43% :1! S. -_ I_g'I=-cI_. -I IF:.LLiLiF_I I 1 srcn%Pf1:|7rme:ao1‘ |LLJL¢J_fl ~ .4 1 !=_j,_.JI__1.u h‘ E; E 52:: E} HAcE@ M-HI EZEZD Locllzfliillll i[E_§|:___|[_'|gf§!w_ ll.- |_ I... AGE Eli-aw: ============================================= ./texts/FBIZodiac6/358.txt ======= L~.L5_|.1«_ 51.3 1 fiLSfi3 DATE N'AME ENCODED: F'GH- 1"» 3 ’ 4 M5“ '6..- 7.. -8 '9 ‘PET M _FPGL[:' J Pi } ij i fl I rpcggmy$| !fibH I f7Vi sEx m RAGEEE .- - ~- -- -r t.;:' -..-.-..-N-»" LOG Cram: I1iJ|_,1i an _~1I:“1:1:.: . 1=-as E , AGE Es:-we HGT'[ - | WGT E -1: ;; HAIR [w__| EvE5[' I _ - SHIT 1:”‘J_J_: ============================================= ./texts/FBIZodiac6/359.txt ======= CASE N'L)wii3”E%aiz.—LA:L %:%_a;fJ%“;.-»‘1L;|;l.»;""'$"I'..§:~.i.£“.’:, st; :=an~ 2... 3 4 '6... T_ --'8 9 1 PET IJ ' , FP+t=_L__r”‘“-J rm: 2 LLLJ H % ‘am H a if” FP¢'._7!-_,!;__$l__]_‘_ I I“'a L__Ei.._i._l|_IJi_.,£_JLM%_A:lE ‘sex RAGE Ac - .n.- : —-,9; « _ _- . . __ ,._-~ .,<;>_.-h_-:3-,_=_-_.=-....._=.. .-¢,;;_., ._ ~.; ,. '. ,.._~._:fi.-;_--,\...;_____ _ L01: L(‘.,fi1[ I jl %} L__J| i‘,r| .|% I at C ============================================= ./texts/FBIZodiac6/360.txt ======= flLSfl3' .-.-R.-ua<2'F . W, _ N.AME.:‘ __ ENCODED. %cgss ’~umBEmg gag F;-,;';'.' 3 ' 4 ...5i' '3” 7_ --8 9 1: -1:-1=:*r W o _ ' .- '_I=PcL_1_- L.1>ml’T:1DL;4I_ H I II We IV]-_J%5 ,=p¢-;._.!';_’|hJ: 1£;i;L__%___jg°o| [31 i |Li i|__| II :17" r'.'.:, air‘; ' . "*°a sax E3 fiA£:E'?;] *AOH~C. FOB E K95 [35 f"-ti‘! HGT-I: E -% WG-1‘ C r -I I ? HMRC EYESCXI ‘ SHIT CZ ============================================= ./texts/FBIZodiac6/361.txt ======= flL3fl3 L ' DATE W" = NAME ENCODEDI C}{$E'i;JUt’N.«'1'B'E''i3i.':fitj.. ; ;;. nu.-.n~ 2... 3 ' 4 --5: 6., 7. ~-8 9 1 "PET _ 5' '_ ___ I-\.M-vww _FPcL_EI]T5T51“|””ME?’”E7__V“?”“é : Ilia 151 ‘ L. :=pcgg_L:J4 LJ>i.0...! |_!_1 ,1 L44 |_|_| "six mg nncagg -A0H~EEEE]I Lac ‘ii I .|._ ! F‘ L‘ ============================================= ./texts/FBIZodiac6/362.txt ======= fiL3A3 - DATE N'AME ENCODED: FEE? 2.. 3 V 4 «SI 6., 1*. -3 9 1 -1:31‘ I3 _ .w___ 1=|=c_I._I: - rml L-3J£_L_| I IId3I3L.i_II,_li__ ILE I|_.LJL.L_3|: sax Ea pp-¢;;5|Hh15:___r_ i‘.~.|o* I ifllrill LA! I r.''.,,_ [H I, _ -- N3 I. RACEE;-_,"_1 |.r_::c am: I: I IF I ml II I“! II‘? I‘:__ 1=-on E‘ r_.,,_ AGE E-.:_s'- yr Hm‘ E I ~ I I war I: — '_f HAIRE EYES I , “ SHIT CE ' ============================================= ./texts/FBIZodiac6/363.txt ======= flL3fi3 DATE NAME‘ "49 * _ - M~ _ ENCODED. -2-co;-. E ran. 2,. 3' 4 -5: '5_, 7 1 -Pnr _w¥ _ - T“ (ifiSE'NUKfl3ER:§fl|;“4§{4iJA?s’@gMg¢' % 3 H i_| I! H0: -’ 3-’ %} FP¢LC;J 3 FFGQEHEEII 1'": r—I ‘bu "SEX fig RAGEEQ LOG Em1l||% IL Alli 3L; g11;IgL_ (I 1:% 0 'LLy l; ============================================= ./texts/FBIZodiac6/364.txt ======= fii.3fl3 DATE t 40 NAME ENCODED: L dAsE I"~il".'¥'I'»'a1'B_E.Ié.-'_fi’.";".'* .21 Qéqlaa .”: é 4:" :=Gn".' 3 ' 4 'B_, 7_ V8 9 1 "PET _ - 1" _rI=cL_E --ii: 1 I if E H _l§-'-Jétlé I I I |§ Fa:-r.-._~:-ILA %l!1 ':""'i: Film |ir?JE.jJ_|_.§L_I:|i_' Lac EL*=_JAH |""‘;I | u '2'.» M; FOB {_ AGE |1:.?_;;_—5.'§t_:» HGT CJ E -1 1 war [ HAIHE E'YEs['|_T_: SHIT [I ============================================= ./texts/FBIZodiac6/365.txt ======= ‘PR1’ ', fiL$fl3 DATE . 1:» NAME? ‘*4 ENcoDED:_____; case Ncmseamy %g% .4 4 W. .»,7% -3 '91 Fan: T =2w 3 4 »5"6y I=Pc.-I.E—I ii I al IF” J|0.;1!i?|' I:_h' "'r1=::':g|_;_w{;::“‘1 "T " Li I! LLJI 1””? 03iCI $7577" I“ _ sax fig ancagg A95 _ ._ . . . .. LOG Lflflé JH [L2 11 IE1 !I.fi“ Po: CI: AGE ET .5'— “zrésr HGT E ~| I WET E -L_._1._J HA|n[: % ~ E'YEs[‘_f _ SHIT [ [ _ ============================================= ./texts/FBIZodiac6/366.txt ======= -«*-fi..*.- - D-335 FIRI D1736 $3’-E“ _ E-.11:-J2 RR RUCNF3 5”“ ' -“9”E5E3 -“r'wa's'r,I5n:nr¢ DE FBISC #0095 0571359 1:42 uuuuu R Zfilflfifll FEfl_9l _ ' _, -o-c PH I=_a:'_s,uc_HanE'n'ru [#3-'SLt-153511! {F} "*5"- TI] IEECTDIE FBI I‘9--HIGIIHIUUTINEJ 31- = "r ‘u c:..us;" . . .N ,.*gAm "'°U’.-*~:;.«’ W _{Efi§§:lHfl DANEERQUS i:11.'E= Hsvzou ' fig PfiSSl IOEflTIFIChTIflH 0I?ISIflH9 LATENT FINGERPRIHT SEQTIDH.' fix l.c-“H § SukJ£tr xTuaT1nN: Iomsc: . JL RE SACRENEHTD TELETTPE'TD THE FEI IDENTIFIEATIDHIDIVISIUN Vb nan:-9 1r.ezr-91. REQUEET III? THE BUREAU; IEIENTIFIE-ILTIDN DIVISIDN; LATENT 9—— é«?M.:= 6123.. .. . ificrns-Asia ‘me LlLi'E}IT PRINTS neveutweu an ::-2 mg an-3 In p!fi:¥*iI1mc;.s'aa-'_¥£a:a_ F:ng_Em-n;g-av secajran; Lf . ._ - .!HE LATENT FIHEEEPRINT sectlcm Is R£iHJESIED"l'EI EXEEDITIDHSLT-' U1“ _"I-| 5:}; "K NUMBER A109-ea‘ um-1 THE IHKED r=mv;Esu-nuts ma FILE IN ‘rice FlPR.L4:-.a_l%9§! \%m$£i£§$& fJ¢f:':.‘- H E 3' 5.7-. - ============================================= ./texts/FBIZodiac6/367.txt ======= " __nt==fIII*_="' P-AGE-THE DE F3155 GU05 UNCL3-5 _ I9-EHTIFICATIGHI DI'v1’5II3rvI__':gF:f§.i'C‘[_H;!§_§l:E;II5[3t'f.iiI.:.i.E;tl"Jp9 “jf_L_I._€‘}i Is a HHITE nu._E, 3ukr4g2,r1a:3_3. HE ms FE-I HUI-IBEQ %__§;':7’,g_1_"_*.‘_!l'_E_‘°.:h Ir I5 REQUESTEIJ IHE RESULTS m= THESE CEH-!PnR1SDhlS as TELEPHUHICALLT prmvzascr SPEEIAL A|3E'h,'T FHIRFIELD RESIDENT meezcw , l '1*5p,’e‘1'=Iu_:n.-as-.'t 1'97) +23- — __ "’-"-‘*."$H'E.:;.rrEn*r'."';51Mv;En'rn:r+'r--séI:¥Iur«r*'Is- FuR'THER" i=E'nuEsTEEJ' rt!" ’ l3£HiP._HR§-g:.£§;'ii§'ggg_§_e_FINEERPRIHTS any nu. LI-TENT PnINrs'nEvELcwE1:-'_ E-5mi;-zgu:-Iyauri:s'(;a.-.11g3ai_-n.;_TI;?13s' p_ERr{ITs.___'_ ‘ _ _ *'J=fi:=.:1'n+s_1urannnr1au' ml: was 1neu'r1|=tcn'1m.- nrvrsmn, Ln-rem FIHGERPRIHT--SECTIBM THEEVALLEJD: cn.:s=uk~n 1=u:.1r.:E DEF‘-I-RTP'lEHT.i -uurcH'Hns RE-IHsTITu¥ED-ITS:INVESTIGLTIUH as THE 2no:;c KILLIHG5 _ ' ‘rm Icy-i_;3:i gttfitsiau If I'M}: _- mu. LE_.l{I - PnILI£EE..- ueunneun :.u'~rIsr;n TI-H1‘ HIS-,I-EEi~lC'!"'IS cURF.ENI‘L'r v:£uIHs1.i_"J‘+r_u: «,=§_L_-§:_a:,+'~:.g.t;t_;f.a2a.- sax nuna£k_--1r;r21aLz_.- AS A SUSPECT III THE l4IL!:.IN45-5. q:'.tiv1:_.sb.*rn-un1~4nr.1.E_ii was ccmsmsaea 1." runs susracr HHEN ma mm-Ens F':R§T nccuMtEn. St-DR.I2'IEHTfl H=.l5'RE'u'IEHE_I!I THIS FILE gun cnum FIi_~iD an itlscartn cw H.Ev1au§.'REa'uEsr5 -Tfl cm-mucr ::nHn.usa$as §HI'THT’ifi.:._I'5'!1*5"P1:'r1Ts.' ' ‘ " " "H ' " Lelns’ H” " ' _ H "_sncnm-asnra, AT m.LE.:a,. cnrsnnuzax -um. rumnm cgN‘rM:*r "1T"'-'fl' ‘MU-E-I'D H”-1'35 DE”-“THENTs RE -H-|.‘rE:IITID!«ihL |. '.'-h.\... .......... ============================================= ./texts/FBIZodiac6/368.txt ======= 33,; PAGE THREE DE FBISIE,‘ BOOB Lu'NCLdS D-E'|FELE|P-HEHTEIN IHE l'.|Ii|J-1-.l_l2 II-su'iE51"'iv;P_rI:iu-. MU'tEfl AND fl.Il'£GEE€I1.!S -*-. Y‘; ============================================= ./texts/FBIZodiac6/369.txt ======= Idenxuandhrn 3 est’ - ¢m33J'§5\. 1:.» . c: *3 2-.. ' g:§i _‘ . } l " - 5*”a:¢**“?n = DIRECTUR, PEI [9~4§511] vet 4I24f91 Fmm : , SACRAMENTO :eA—ec—153§1l go} Subinsl-;""- _Ifl.5 ‘I .- EKTDRTIDN; 00: SC - ‘E 33: Identification Division form.lr33E, Hated 3f29F91. Dn iflfiffil, the results of the FBI identification Divisio .Le rint Sectionls examinations were ptouided ta“ ‘s’ellejo, California. The pnotograpliis of b”r’C« the an en in-;terpr' rovi-:'|e the Identification Division I:»._7_e also iven tofl dvi$ed that he still pursuing lea_e"ifi“t e Zodiac nveetiga on t has not developed any new sifinifioant information. . Inasmuch es the investigation being conducted by the vailejo Police Department nae not produced any Significant results which W-:I=.J1fl Warrant the Bureau‘; further involvement in this matter, Sacramento is conducting no further investigation at this time. Sacramento -N111 continue to provide eseiatance to the Vallejo Police Department if requested in the future. § 9 ~4/9‘?// -2955 _,,_.-- - B'|.11‘Q3:.z — Sacramento RJHIHS Ii 4} IE HflY 8 E31 1* . _ 5* ============================================= ./texts/FBIZodiac6/370.txt ======= U E III £3 I N A L Care 1 Specs I|!tau:h:I.' .- roaats (aw. s-29-15] I F“ }" /Q1] I'R.e'-SIQSMIT '5-"Ir-1: FREE.-CEDE|_.‘1CE: CLa»SSEl'I(‘.ATION: I D Teetype U Inmaedmi-2_ E} TOP HCREI _ D_P'Fa.csi1:3iIe_.,,,_H,.4 13 Priority III SECRET E El Rirulizte I3 CCIH'.I‘lIIEi\!TmJ..- - D I_:m31.a,s EFT 0 .:, El 1r‘NCLAs - —na+=**??i‘s*rf16I.9t'-s= 1 TD : DIREC.'T9R;-- FBI {E-3|-49911} I _ 2 IIELTTN: FE-_I LAB, Technical Evaluation Unit} '3. — _ «es-?§JI_m.'.-$.1.“:9‘3?’-%*!} =dL;‘s.?3_;Eféf§DDIAcr1de"_ by . _ 1. . ....o¢...- U 11234004 __ ."_- -L 794 RE 51? ai;-tel ta Bureau, 5:29:31. __ . P 8 RE UEST OF ’3']-IE BURE U: 9 _ ' -_ , . The FBI Lab, Technical Evaluation Unit, is _, 11.‘! _1:eque-eted to analyze the eru::1oE:.ec'i_ document to determine if it - - haeany validity in breaking the nude used by the zodiac _. 11- -kiILJ.er in_ referenced airtel. 13 For information of the Bureau. thie case dates back 13 tn the late 196n'.'He and early 19'.'u'I3I"e when an unknown male [ kil_fLe:1 at least five individuals in Northern California. The UFSUB was named The Zodiac: Killer after he sent -several , letters to newspapers; claiming the murders and signing the is; lettere with '*Z|::|:1i_a,c." Same cf the lettere were in code. -- .15 _ - I EUBB, em in-ciivi DES by the :1 me ' ' of {true nee-ae , Dofif kl,/]'l‘.-1’: has been contac t: e an Free :1 :3 aimin the. - non osj san ' 18" Francisco, is e 0 ac'._ki11er. ' - H3’ ' 15 LJ22 FBIHQ Jrrt g’, '21: 3 _ 5]? -’r T”? ?3‘f""”““ M“ 21 1, ref? lg ;. ., -51?’? Approved: ‘I'rans1-a,i1-ted Pen: r-. J.'NurrLJ:nar) I?'Iiune]- ============================================= ./texts/FBIZodiac6/371.txt ======= ¢1aims that he was out of the coun1‘_‘ry during the n 1 murders but that his passport is. last and he cannot prove it. ' _ On 12,-'1'J"fS|1,‘delivered to the FBI 5; Christmas Carfi Efid an 113-page:dDcument entitlea “Rules 0: Decoding the Haunt Diablo Code" by san Francisco is requesting that this dacument be analyzed to determine if it has any validity in breaking the 30d? U59d b3 the Zodiac. It should he noted that the two—line nude with which this document begjpe was contained in a Zodiac 'lBti.‘.“e'l:'*flatrEd.__fi_,I"25..I'?U to the Sarg__.§‘1§enci5r_'.G Chronicle {copy on " page 115}. M ============================================= ./texts/FBIZodiac6/372.txt ======= .—-;_]_m,.;,1.1L.5II) P _ 3 __ ' FEEERAL BUREAU OF It~_wEsT1G_gaTI§J‘i